Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SPJ_RS02525 | Genome accession | NC_012466 |
| Coordinates | 481611..481760 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae JJA | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 476611..486760
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPJ_RS02495 (SPJ_0494) | blpC | 476898..477026 (-) | 129 | WP_000358815.1 | quorum-sensing system pheromone BlpC | - |
| SPJ_RS02500 (SPJ_0495) | - | 477083..478444 (-) | 1362 | WP_001069060.1 | bacteriocin secretion accessory protein | - |
| SPJ_RS02505 (SPJ_0496) | comA/nlmT | 478455..480131 (-) | 1677 | WP_196300924.1 | peptide cleavage/export ABC transporter | Regulator |
| SPJ_RS13640 | comA/nlmT | 480025..480612 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| SPJ_RS02515 (SPJ_0498) | blpM | 480894..481148 (+) | 255 | WP_001093256.1 | two-peptide bacteriocin subunit BlpM | - |
| SPJ_RS02520 (SPJ_0499) | blpN | 481164..481367 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| SPJ_RS02525 (SPJ_0500) | cipB | 481611..481760 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| SPJ_RS02530 (SPJ_0502) | - | 481864..481983 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SPJ_RS11585 (SPJ_0503) | - | 482281..482445 (+) | 165 | WP_000727117.1 | hypothetical protein | - |
| SPJ_RS11590 (SPJ_0504) | - | 482507..482845 (+) | 339 | WP_088804618.1 | immunity protein | - |
| SPJ_RS02550 (SPJ_0506) | - | 483474..483857 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| SPJ_RS02555 (SPJ_0507) | - | 483909..484598 (+) | 690 | WP_000760520.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPJ_RS02560 (SPJ_0508) | blpZ | 484640..484888 (+) | 249 | WP_000276501.1 | immunity protein BlpZ | - |
| SPJ_RS02565 (SPJ_0509) | - | 484918..485529 (+) | 612 | WP_000394043.1 | type II CAAX endopeptidase family protein | - |
| SPJ_RS02570 (SPJ_0510) | - | 485690..486484 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=33139 SPJ_RS02525 WP_001809846.1 481611..481760(+) (cipB) [Streptococcus pneumoniae JJA]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=33139 SPJ_RS02525 WP_001809846.1 481611..481760(+) (cipB) [Streptococcus pneumoniae JJA]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |