Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | FQB22_RS03120 | Genome accession | NZ_CP042252 |
| Coordinates | 586156..586296 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain KNU11 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 581156..591296
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQB22_RS03095 | - | 581453..581842 (-) | 390 | WP_003184847.1 | hotdog fold thioesterase | - |
| FQB22_RS03100 | comA | 581859..582497 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| FQB22_RS03105 | comP | 582584..584890 (-) | 2307 | WP_003184851.1 | ATP-binding protein | Regulator |
| FQB22_RS03110 | comX | 584913..585077 (-) | 165 | WP_003184853.1 | competence pheromone ComX | - |
| FQB22_RS03115 | comQ | 585086..585967 (-) | 882 | WP_003184856.1 | polyprenyl synthetase family protein | Regulator |
| FQB22_RS03120 | degQ | 586156..586296 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| FQB22_RS03130 | - | 586815..587129 (+) | 315 | WP_231105283.1 | SDR family oxidoreductase | - |
| FQB22_RS03135 | - | 587172..588392 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| FQB22_RS03140 | - | 588571..590040 (-) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| FQB22_RS03145 | - | 590058..590609 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| FQB22_RS03150 | - | 590794..591195 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=330658 FQB22_RS03120 WP_003184860.1 586156..586296(-) (degQ) [Bacillus licheniformis strain KNU11]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=330658 FQB22_RS03120 WP_003184860.1 586156..586296(-) (degQ) [Bacillus licheniformis strain KNU11]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |