Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   FQB22_RS03120 Genome accession   NZ_CP042252
Coordinates   586156..586296 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   A0ABM6LMF9
Organism   Bacillus licheniformis strain KNU11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 581156..591296
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQB22_RS03095 - 581453..581842 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  FQB22_RS03100 comA 581859..582497 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  FQB22_RS03105 comP 582584..584890 (-) 2307 WP_003184851.1 ATP-binding protein Regulator
  FQB22_RS03110 comX 584913..585077 (-) 165 WP_003184853.1 competence pheromone ComX -
  FQB22_RS03115 comQ 585086..585967 (-) 882 WP_003184856.1 polyprenyl synthetase family protein Regulator
  FQB22_RS03120 degQ 586156..586296 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  FQB22_RS03130 - 586815..587129 (+) 315 WP_231105283.1 SDR family oxidoreductase -
  FQB22_RS03135 - 587172..588392 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  FQB22_RS03140 - 588571..590040 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  FQB22_RS03145 - 590058..590609 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  FQB22_RS03150 - 590794..591195 (-) 402 WP_003184870.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=330658 FQB22_RS03120 WP_003184860.1 586156..586296(-) (degQ) [Bacillus licheniformis strain KNU11]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=330658 FQB22_RS03120 WP_003184860.1 586156..586296(-) (degQ) [Bacillus licheniformis strain KNU11]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652