Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE   Type   Machinery gene
Locus tag   EGH12_RS01310 Genome accession   NZ_CP034020
Coordinates   221405..221800 (+) Length   131 a.a.
NCBI ID   WP_003703428.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain FQ48     
Function   DNA binding (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 222586..254098 221405..221800 flank 786


Gene organization within MGE regions


Location: 221405..254098
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGH12_RS01310 (EGH12_01310) comE 221405..221800 (+) 396 WP_003703428.1 helix-hairpin-helix domain-containing protein Machinery gene
  EGH12_RS01315 (EGH12_01315) comP 221888..222337 (+) 450 WP_002214937.1 type IV pilin protein Machinery gene
  EGH12_RS01325 (EGH12_01325) - 222714..222860 (-) 147 WP_003691757.1 hypothetical protein -
  EGH12_RS01330 (EGH12_01330) - 223247..223837 (+) 591 WP_080229150.1 DNA cytosine methyltransferase -
  EGH12_RS01335 (EGH12_01335) - 223834..224205 (+) 372 WP_012503918.1 DNA cytosine methyltransferase -
  EGH12_RS14040 - 224219..225076 (+) 858 WP_012503917.1 ATP-binding protein -
  EGH12_RS14045 - 225266..225862 (+) 597 WP_012503916.1 TIGR02391 family protein -
  EGH12_RS01345 (EGH12_01345) - 225868..226290 (+) 423 WP_003691751.1 very short patch repair endonuclease -
  EGH12_RS01350 (EGH12_01350) - 226429..227760 (+) 1332 WP_050155400.1 replication initiation factor domain-containing protein -
  EGH12_RS01355 (EGH12_01355) - 227805..228095 (+) 291 WP_002216601.1 hypothetical protein -
  EGH12_RS01360 (EGH12_01360) - 228100..228297 (+) 198 WP_003689600.1 hypothetical protein -
  EGH12_RS01365 (EGH12_01365) - 228371..228589 (+) 219 WP_003691584.1 major capsid protein -
  EGH12_RS01370 (EGH12_01370) - 228596..228874 (+) 279 WP_003689168.1 hypothetical protein -
  EGH12_RS01375 (EGH12_01375) - 229002..229319 (+) 318 WP_003689167.1 DUF1132 family protein -
  EGH12_RS01380 (EGH12_01380) - 229261..230850 (+) 1590 WP_165865522.1 IgG-binding virulence factor TspB family protein -
  EGH12_RS01385 (EGH12_01385) - 230829..231119 (+) 291 WP_047917922.1 DUF2523 domain-containing protein -
  EGH12_RS01390 (EGH12_01390) - 231129..232214 (+) 1086 WP_003700139.1 zonular occludens toxin domain-containing protein -
  EGH12_RS01395 (EGH12_01395) - 232335..232694 (+) 360 WP_003689732.1 hypothetical protein -
  EGH12_RS01400 (EGH12_01400) - 233206..234168 (+) 963 WP_050156280.1 IS110-like element ISNgo2 family transposase -
  EGH12_RS14490 - 234352..234480 (+) 129 WP_012503747.1 hypothetical protein -
  EGH12_RS01410 (EGH12_01410) - 234497..234877 (-) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  EGH12_RS14050 - 234868..235149 (-) 282 WP_003689109.1 hypothetical protein -
  EGH12_RS01415 (EGH12_01415) - 235178..235327 (-) 150 WP_003689110.1 hypothetical protein -
  EGH12_RS01420 (EGH12_01420) - 235504..235998 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  EGH12_RS01425 (EGH12_01425) - 236037..236243 (-) 207 WP_044271496.1 hypothetical protein -
  EGH12_RS01430 (EGH12_01430) - 236313..237095 (-) 783 WP_025456432.1 ATP-binding protein -
  EGH12_RS01435 (EGH12_01435) - 237110..238120 (-) 1011 WP_050153770.1 helix-turn-helix domain-containing protein -
  EGH12_RS01440 (EGH12_01440) - 238117..238344 (-) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  EGH12_RS01445 (EGH12_01445) - 238517..238705 (+) 189 WP_003698903.1 hypothetical protein -
  EGH12_RS01450 (EGH12_01450) - 238682..238837 (-) 156 WP_003689578.1 hypothetical protein -
  EGH12_RS01455 (EGH12_01455) - 238917..239132 (-) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  EGH12_RS01460 (EGH12_01460) - 239260..239964 (+) 705 WP_003702453.1 helix-turn-helix transcriptional regulator -
  EGH12_RS01465 (EGH12_01465) - 240124..240663 (+) 540 WP_003695998.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  EGH12_RS01470 (EGH12_01470) - 240664..241023 (+) 360 WP_003691733.1 hypothetical protein -
  EGH12_RS01475 (EGH12_01475) - 241040..241258 (-) 219 WP_003691731.1 hypothetical protein -
  EGH12_RS01480 (EGH12_01480) - 241742..241942 (+) 201 WP_047920246.1 hypothetical protein -
  EGH12_RS01485 (EGH12_01485) - 241975..242451 (+) 477 WP_002255718.1 hypothetical protein -
  EGH12_RS01490 (EGH12_01490) - 242448..242681 (+) 234 WP_124935080.1 hypothetical protein -
  EGH12_RS01495 (EGH12_01495) - 242822..243154 (+) 333 WP_003705604.1 hypothetical protein -
  EGH12_RS01500 (EGH12_01500) - 243307..243585 (+) 279 WP_003691529.1 hypothetical protein -
  EGH12_RS01505 (EGH12_01505) - 243582..243743 (+) 162 WP_003693867.1 hypothetical protein -
  EGH12_RS01510 (EGH12_01510) - 243812..244498 (+) 687 WP_042758540.1 hypothetical protein -
  EGH12_RS01515 (EGH12_01515) - 244638..244820 (+) 183 WP_003691535.1 hypothetical protein -
  EGH12_RS01520 (EGH12_01520) - 244817..245308 (+) 492 WP_047916888.1 siphovirus Gp157 family protein -
  EGH12_RS01525 (EGH12_01525) - 245360..245575 (+) 216 WP_003691538.1 hypothetical protein -
  EGH12_RS01530 (EGH12_01530) - 245686..246669 (+) 984 WP_047952517.1 hypothetical protein -
  EGH12_RS13310 - 246666..246896 (+) 231 WP_003695893.1 hypothetical protein -
  EGH12_RS01535 (EGH12_01535) - 246868..247815 (+) 948 WP_012503904.1 hypothetical protein -
  EGH12_RS01540 (EGH12_01540) - 247923..248189 (+) 267 WP_003689557.1 pyocin activator PrtN family protein -
  EGH12_RS01545 (EGH12_01545) - 248239..249393 (-) 1155 WP_003697468.1 tyrosine-type recombinase/integrase -
  EGH12_RS01550 (EGH12_01550) dusA 249513..250529 (+) 1017 WP_003689555.1 tRNA dihydrouridine(20/20a) synthase DusA -
  EGH12_RS01555 (EGH12_01555) gluQRS 250599..251486 (-) 888 WP_003689554.1 tRNA glutamyl-Q(34) synthetase GluQRS -
  EGH12_RS01560 (EGH12_01560) - 251503..251793 (-) 291 WP_003689553.1 hypothetical protein -
  EGH12_RS14495 - 251798..251932 (-) 135 WP_012503902.1 hypothetical protein -
  EGH12_RS01565 (EGH12_01565) tal 251944..252999 (-) 1056 WP_003689551.1 transaldolase -
  EGH12_RS01570 (EGH12_01570) - 253096..254070 (+) 975 WP_003689550.1 KpsF/GutQ family sugar-phosphate isomerase -

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 13796.61 Da        Isoelectric Point: 10.8790

>NTDB_id=328127 EGH12_RS01310 WP_003703428.1 221405..221800(+) (comE) [Neisseria gonorrhoeae strain FQ48]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK

Nucleotide


Download         Length: 396 bp        

>NTDB_id=328127 EGH12_RS01310 WP_003703428.1 221405..221800(+) (comE) [Neisseria gonorrhoeae strain FQ48]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG

Domains


Predicted by InterproScan.

(52-110)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1


Multiple sequence alignment