Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   EG882_RS01385 Genome accession   NZ_CP033967
Coordinates   239213..239332 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain 1B-23     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 234213..244332
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EG882_RS01360 (EG882_01360) - 234454..235212 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  EG882_RS01365 (EG882_01365) - 235206..236153 (-) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  EG882_RS01370 (EG882_01370) ceuB 236143..237096 (-) 954 WP_059366593.1 ABC transporter permease Machinery gene
  EG882_RS01375 (EG882_01375) - 237510..238874 (+) 1365 WP_094031502.1 aspartate kinase -
  EG882_RS01380 (EG882_01380) - 238969..239064 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  EG882_RS01385 (EG882_01385) phrC 239213..239332 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  EG882_RS01390 (EG882_01390) rapC 239316..240464 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  EG882_RS01395 (EG882_01395) - 240617..242050 (-) 1434 WP_162492834.1 HAMP domain-containing sensor histidine kinase -
  EG882_RS01400 (EG882_01400) - 242037..242720 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=327434 EG882_RS01385 WP_003156334.1 239213..239332(-) (phrC) [Bacillus velezensis strain 1B-23]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=327434 EG882_RS01385 WP_003156334.1 239213..239332(-) (phrC) [Bacillus velezensis strain 1B-23]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment