Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EGX72_RS00145 | Genome accession | NZ_CP033809 |
| Coordinates | 27490..27672 (-) | Length | 60 a.a. |
| NCBI ID | WP_000965649.1 | Uniprot ID | A0AAV3JNR0 |
| Organism | Streptococcus sp. FDAARGOS_521 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 25264..71419 | 27490..27672 | within | 0 |
Gene organization within MGE regions
Location: 25264..71419
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGX72_RS00130 (EGX72_00130) | - | 25264..25839 (-) | 576 | WP_001231504.1 | glycoside hydrolase family 73 protein | - |
| EGX72_RS00135 (EGX72_00135) | - | 25836..26588 (-) | 753 | WP_000739660.1 | M15 family metallopeptidase | - |
| EGX72_RS00140 (EGX72_00140) | - | 26585..27277 (-) | 693 | WP_000049272.1 | histidine phosphatase family protein | - |
| EGX72_RS00145 (EGX72_00145) | prx | 27490..27672 (-) | 183 | WP_000965649.1 | hypothetical protein | Regulator |
| EGX72_RS00150 (EGX72_00150) | - | 27901..28413 (-) | 513 | WP_000634505.1 | PBECR4 domain-containing protein | - |
| EGX72_RS00155 (EGX72_00155) | - | 28779..30113 (-) | 1335 | WP_000257233.1 | GH25 family lysozyme | - |
| EGX72_RS00160 (EGX72_00160) | - | 30239..30493 (-) | 255 | WP_000611524.1 | phage holin | - |
| EGX72_RS00165 (EGX72_00165) | - | 30495..30797 (-) | 303 | WP_000215499.1 | hypothetical protein | - |
| EGX72_RS00170 (EGX72_00170) | - | 30810..31022 (-) | 213 | WP_000698337.1 | hypothetical protein | - |
| EGX72_RS00175 (EGX72_00175) | - | 30997..31326 (-) | 330 | WP_000494205.1 | DUF1366 domain-containing protein | - |
| EGX72_RS00180 (EGX72_00180) | - | 31352..33357 (-) | 2006 | Protein_34 | DUF859 family phage minor structural protein | - |
| EGX72_RS00185 (EGX72_00185) | - | 33368..37502 (-) | 4135 | Protein_35 | glucosaminidase domain-containing protein | - |
| EGX72_RS00190 (EGX72_00190) | - | 37493..39016 (-) | 1524 | WP_060794297.1 | distal tail protein Dit | - |
| EGX72_RS00195 (EGX72_00195) | - | 39013..42954 (-) | 3942 | WP_000526768.1 | phage tail tape measure protein | - |
| EGX72_RS11535 | - | 42967..43140 (-) | 174 | WP_000928086.1 | hypothetical protein | - |
| EGX72_RS00200 (EGX72_00200) | - | 43164..43484 (-) | 321 | WP_000273026.1 | hypothetical protein | - |
| EGX72_RS00205 (EGX72_00205) | - | 43592..44149 (-) | 558 | WP_000521115.1 | major tail protein | - |
| EGX72_RS00210 (EGX72_00210) | - | 44165..44590 (-) | 426 | WP_000559945.1 | hypothetical protein | - |
| EGX72_RS00215 (EGX72_00215) | - | 44587..44964 (-) | 378 | WP_000160229.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EGX72_RS00220 (EGX72_00220) | - | 44961..45308 (-) | 348 | WP_000632972.1 | phage head closure protein | - |
| EGX72_RS00225 (EGX72_00225) | - | 45305..45607 (-) | 303 | WP_000301152.1 | head-tail connector protein | - |
| EGX72_RS00230 (EGX72_00230) | - | 45743..46924 (-) | 1182 | WP_000461336.1 | phage major capsid protein | - |
| EGX72_RS00235 (EGX72_00235) | - | 46949..47614 (-) | 666 | WP_001126088.1 | head maturation protease, ClpP-related | - |
| EGX72_RS00240 (EGX72_00240) | - | 47592..48812 (-) | 1221 | WP_000007730.1 | phage portal protein | - |
| EGX72_RS00245 (EGX72_00245) | - | 48842..49045 (-) | 204 | WP_001042282.1 | hypothetical protein | - |
| EGX72_RS11540 | - | 49042..49209 (-) | 168 | WP_000578946.1 | hypothetical protein | - |
| EGX72_RS00250 (EGX72_00250) | - | 49206..50960 (-) | 1755 | WP_025194528.1 | terminase large subunit | - |
| EGX72_RS00255 (EGX72_00255) | - | 50964..51194 (-) | 231 | WP_000805624.1 | hypothetical protein | - |
| EGX72_RS00260 (EGX72_00260) | - | 51197..51664 (-) | 468 | WP_000532792.1 | phage terminase small subunit P27 family | - |
| EGX72_RS00265 (EGX72_00265) | - | 51828..52172 (-) | 345 | WP_001247767.1 | HNH endonuclease | - |
| EGX72_RS00270 (EGX72_00270) | - | 52273..52458 (+) | 186 | WP_001132272.1 | type II toxin-antitoxin system HicA family toxin | - |
| EGX72_RS00275 (EGX72_00275) | - | 52511..52888 (+) | 378 | WP_000964195.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| EGX72_RS00285 (EGX72_00285) | - | 54094..54528 (-) | 435 | WP_000142570.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EGX72_RS00290 (EGX72_00290) | - | 54920..55186 (-) | 267 | WP_000660740.1 | hypothetical protein | - |
| EGX72_RS00295 (EGX72_00295) | - | 55183..55716 (-) | 534 | WP_060794278.1 | DUF1642 domain-containing protein | - |
| EGX72_RS11545 | - | 55713..55856 (-) | 144 | WP_000564610.1 | hypothetical protein | - |
| EGX72_RS11550 | - | 55860..56024 (-) | 165 | WP_162489522.1 | hypothetical protein | - |
| EGX72_RS11555 | - | 56076..56234 (-) | 159 | WP_017646174.1 | hypothetical protein | - |
| EGX72_RS00300 (EGX72_00300) | - | 56218..56514 (-) | 297 | WP_038405996.1 | nucleotide modification associated domain-containing protein | - |
| EGX72_RS00305 (EGX72_00305) | - | 56526..56871 (-) | 346 | Protein_63 | hypothetical protein | - |
| EGX72_RS00310 (EGX72_00310) | - | 56852..57178 (-) | 327 | WP_000206193.1 | VRR-NUC domain-containing protein | - |
| EGX72_RS00315 (EGX72_00315) | - | 57422..58936 (-) | 1515 | WP_029665793.1 | DNA primase family protein | - |
| EGX72_RS00320 (EGX72_00320) | - | 58932..59735 (-) | 804 | WP_123957697.1 | bifunctional DNA primase/polymerase | - |
| EGX72_RS00325 (EGX72_00325) | - | 59739..60200 (-) | 462 | WP_000494143.1 | DUF669 domain-containing protein | - |
| EGX72_RS00330 (EGX72_00330) | - | 60216..61559 (-) | 1344 | WP_060794304.1 | DEAD/DEAH box helicase | - |
| EGX72_RS00335 (EGX72_00335) | - | 61546..62238 (-) | 693 | WP_000704953.1 | AAA family ATPase | - |
| EGX72_RS00340 (EGX72_00340) | - | 62225..62539 (-) | 315 | WP_000135595.1 | hypothetical protein | - |
| EGX72_RS00345 (EGX72_00345) | - | 62622..62930 (-) | 309 | WP_047198762.1 | hypothetical protein | - |
| EGX72_RS11630 | - | 63060..63845 (-) | 786 | WP_253257042.1 | polymer-forming cytoskeletal protein | - |
| EGX72_RS00360 (EGX72_00355) | - | 63879..64103 (-) | 225 | WP_000431164.1 | hypothetical protein | - |
| EGX72_RS00365 (EGX72_00360) | - | 64132..64389 (-) | 258 | WP_016480517.1 | hypothetical protein | - |
| EGX72_RS00370 (EGX72_00365) | - | 64468..64644 (-) | 177 | WP_000728090.1 | helix-turn-helix domain-containing protein | - |
| EGX72_RS11560 | - | 64759..64935 (+) | 177 | WP_017645150.1 | hypothetical protein | - |
| EGX72_RS00375 (EGX72_00370) | - | 64963..65154 (-) | 192 | WP_001003168.1 | hypothetical protein | - |
| EGX72_RS00380 (EGX72_00375) | - | 65173..65694 (-) | 522 | WP_000032137.1 | hypothetical protein | - |
| EGX72_RS00385 (EGX72_00380) | - | 65687..66646 (-) | 960 | WP_001156317.1 | hypothetical protein | - |
| EGX72_RS00390 (EGX72_00385) | - | 66700..66906 (-) | 207 | WP_000164462.1 | helix-turn-helix transcriptional regulator | - |
| EGX72_RS00395 (EGX72_00390) | - | 66957..67598 (+) | 642 | WP_123957698.1 | hypothetical protein | - |
| EGX72_RS00400 (EGX72_00395) | - | 67696..67854 (-) | 159 | WP_001104146.1 | hypothetical protein | - |
| EGX72_RS00405 (EGX72_00400) | - | 67913..68125 (+) | 213 | WP_047208985.1 | hypothetical protein | - |
| EGX72_RS11565 | - | 68114..68263 (-) | 150 | WP_017645151.1 | hypothetical protein | - |
| EGX72_RS00410 (EGX72_00405) | - | 68624..69403 (+) | 780 | WP_000095652.1 | S24 family peptidase | - |
| EGX72_RS00420 (EGX72_00415) | - | 69535..70149 (+) | 615 | WP_000742866.1 | hypothetical protein | - |
| EGX72_RS00425 (EGX72_00420) | - | 70322..71419 (+) | 1098 | WP_000570847.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7024.13 Da Isoelectric Point: 4.1954
>NTDB_id=325859 EGX72_RS00145 WP_000965649.1 27490..27672(-) (prx) [Streptococcus sp. FDAARGOS_521]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=325859 EGX72_RS00145 WP_000965649.1 27490..27672(-) (prx) [Streptococcus sp. FDAARGOS_521]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS8232 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
68.333 |
0.483 |