Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EEB07_RS05190 Genome accession   NZ_CP033576
Coordinates   975125..975265 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain NY12-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 970125..980265
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EEB07_RS05165 (EEB07_05165) - 970452..970835 (-) 384 WP_017419422.1 hotdog fold thioesterase -
  EEB07_RS05170 (EEB07_05170) comA 970857..971501 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  EEB07_RS05175 (EEB07_05175) comP 971582..973888 (-) 2307 WP_123117417.1 sensor histidine kinase Regulator
  EEB07_RS05180 (EEB07_05180) comX 973907..974083 (-) 177 WP_017419424.1 competence pheromone ComX -
  EEB07_RS05185 (EEB07_05185) - 974098..974994 (-) 897 WP_017419425.1 polyprenyl synthetase family protein -
  EEB07_RS05190 (EEB07_05190) degQ 975125..975265 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  EEB07_RS05200 (EEB07_05200) - 975731..976072 (+) 342 WP_025285192.1 hypothetical protein -
  EEB07_RS05205 (EEB07_05205) - 976079..977302 (-) 1224 WP_123117418.1 EAL and HDOD domain-containing protein -
  EEB07_RS05210 (EEB07_05210) - 977432..978898 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  EEB07_RS05215 (EEB07_05215) - 978916..979467 (-) 552 WP_123117419.1 isochorismatase family cysteine hydrolase -
  EEB07_RS05220 (EEB07_05220) - 979564..979962 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=324043 EEB07_RS05190 WP_003152043.1 975125..975265(-) (degQ) [Bacillus velezensis strain NY12-2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=324043 EEB07_RS05190 WP_003152043.1 975125..975265(-) (degQ) [Bacillus velezensis strain NY12-2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment