Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D5285_RS18010 Genome accession   NZ_CP033389
Coordinates   3501905..3502045 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain CBMAI 1303     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3496905..3507045
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D5285_RS17980 (D5285_17980) - 3496936..3497325 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  D5285_RS17985 (D5285_17985) comA 3497342..3497980 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  D5285_RS17990 (D5285_17990) comP 3498067..3499686 (-) 1620 WP_122934983.1 sensor histidine kinase Regulator
  D5285_RS17995 (D5285_17995) - 3499826..3500536 (-) 711 WP_183163973.1 hypothetical protein -
  D5285_RS18000 (D5285_18000) comX 3500665..3500835 (-) 171 WP_020452790.1 competence pheromone ComX -
  D5285_RS18005 (D5285_18005) - 3500807..3501718 (-) 912 WP_020452791.1 polyprenyl synthetase family protein -
  D5285_RS18010 (D5285_18010) degQ 3501905..3502045 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  D5285_RS18020 (D5285_18020) - 3502531..3502878 (+) 348 WP_223254849.1 hypothetical protein -
  D5285_RS18025 (D5285_18025) - 3502921..3504141 (-) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  D5285_RS18030 (D5285_18030) - 3504319..3505788 (-) 1470 WP_020452794.1 nicotinate phosphoribosyltransferase -
  D5285_RS18035 (D5285_18035) - 3505806..3506357 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  D5285_RS18040 (D5285_18040) - 3506543..3506944 (-) 402 WP_039072963.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=323585 D5285_RS18010 WP_003184860.1 3501905..3502045(-) (degQ) [Bacillus paralicheniformis strain CBMAI 1303]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=323585 D5285_RS18010 WP_003184860.1 3501905..3502045(-) (degQ) [Bacillus paralicheniformis strain CBMAI 1303]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment