Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   FHI56_RS02570 Genome accession   NZ_CP040804
Coordinates   290857..291087 (+) Length   76 a.a.
NCBI ID   WP_002887015.1    Uniprot ID   -
Organism   Streptococcus salivarius strain LAB813     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 285857..296087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FHI56_RS02545 (FHI56_02545) - 287749..288111 (+) 363 WP_002887019.1 DUF1033 family protein -
  FHI56_RS02550 (FHI56_02550) comGA/cglA/cilD 288191..289132 (+) 942 WP_038676863.1 competence type IV pilus ATPase ComGA Machinery gene
  FHI56_RS02555 (FHI56_02555) comGB 289014..290114 (+) 1101 WP_126405090.1 competence type IV pilus assembly protein ComGB Machinery gene
  FHI56_RS02560 (FHI56_02560) comGC 290123..290437 (+) 315 WP_170314557.1 competence type IV pilus major pilin ComGC Machinery gene
  FHI56_RS02565 (FHI56_02565) comGD 290397..290825 (+) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  FHI56_RS02570 (FHI56_02570) comGE 290857..291087 (+) 231 WP_002887015.1 competence type IV pilus minor pilin ComGE Machinery gene
  FHI56_RS02575 (FHI56_02575) comGF 291074..291511 (+) 438 WP_045769383.1 competence type IV pilus minor pilin ComGF Machinery gene
  FHI56_RS02580 (FHI56_02580) comGG 291489..291806 (+) 318 WP_021144683.1 competence type IV pilus minor pilin ComGG Machinery gene
  FHI56_RS02585 (FHI56_02585) comGH 291851..292807 (+) 957 WP_138261573.1 class I SAM-dependent methyltransferase Machinery gene
  FHI56_RS02590 (FHI56_02590) - 292864..294057 (+) 1194 WP_149561137.1 acetate kinase -
  FHI56_RS02595 (FHI56_02595) - 294308..294505 (+) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  FHI56_RS02600 (FHI56_02600) - 294517..295173 (+) 657 WP_037601483.1 CPBP family intramembrane glutamic endopeptidase -
  FHI56_RS02605 (FHI56_02605) - 295251..295697 (+) 447 WP_013991259.1 hypothetical protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.78 Da        Isoelectric Point: 10.0924

>NTDB_id=323534 FHI56_RS02570 WP_002887015.1 290857..291087(+) (comGE) [Streptococcus salivarius strain LAB813]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=323534 FHI56_RS02570 WP_002887015.1 290857..291087(+) (comGE) [Streptococcus salivarius strain LAB813]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCAGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382