Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   D9C22_RS13085 Genome accession   NZ_CP033064
Coordinates   2511049..2511222 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. WR11     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2506049..2516222
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C22_RS13070 (D9C22_13080) gcvT 2506849..2507937 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  D9C22_RS13075 (D9C22_13085) - 2508378..2510051 (+) 1674 WP_041850014.1 SNF2-related protein -
  D9C22_RS13080 (D9C22_13090) - 2510072..2510866 (+) 795 WP_003230200.1 YqhG family protein -
  D9C22_RS13085 (D9C22_13095) sinI 2511049..2511222 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  D9C22_RS13090 (D9C22_13100) sinR 2511256..2511591 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C22_RS13095 (D9C22_13105) tasA 2511684..2512469 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  D9C22_RS13100 (D9C22_13110) - 2512533..2513105 (-) 573 WP_003246088.1 signal peptidase I -
  D9C22_RS13105 (D9C22_13115) tapA 2513089..2513850 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  D9C22_RS13110 (D9C22_13120) - 2514122..2514448 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C22_RS13115 (D9C22_13125) - 2514490..2514669 (-) 180 WP_003230176.1 YqzE family protein -
  D9C22_RS13120 (D9C22_13130) comGG 2514740..2515114 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  D9C22_RS13125 (D9C22_13135) comGF 2515115..2515498 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  D9C22_RS13130 (D9C22_13140) comGE 2515524..2515871 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=321070 D9C22_RS13085 WP_003230187.1 2511049..2511222(+) (sinI) [Bacillus sp. WR11]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=321070 D9C22_RS13085 WP_003230187.1 2511049..2511222(+) (sinI) [Bacillus sp. WR11]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment