Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D9777_RS17620 Genome accession   NZ_CP033054
Coordinates   3477578..3477718 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Bac57     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3472578..3482718
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9777_RS17595 - 3472875..3473258 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  D9777_RS17600 comA 3473280..3473924 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  D9777_RS17605 comP 3474005..3476308 (-) 2304 WP_021495364.1 histidine kinase Regulator
  D9777_RS21850 comX 3476328..3476507 (-) 180 WP_306383677.1 competence pheromone ComX -
  D9777_RS17615 comQ 3476434..3477447 (-) 1014 WP_021495365.1 class 1 isoprenoid biosynthesis enzyme Regulator
  D9777_RS17620 degQ 3477578..3477718 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  D9777_RS17630 - 3478184..3478525 (+) 342 WP_021495366.1 hypothetical protein -
  D9777_RS17635 - 3478532..3479755 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  D9777_RS17640 - 3479885..3481351 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  D9777_RS17645 - 3481332..3481919 (-) 588 WP_121692600.1 isochorismatase family cysteine hydrolase -
  D9777_RS17650 - 3482016..3482414 (-) 399 WP_021495368.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=320963 D9777_RS17620 WP_003152043.1 3477578..3477718(-) (degQ) [Bacillus velezensis strain Bac57]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=320963 D9777_RS17620 WP_003152043.1 3477578..3477718(-) (degQ) [Bacillus velezensis strain Bac57]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment