Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   D9777_RS14595 Genome accession   NZ_CP033054
Coordinates   2906881..2907318 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain Bac57     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2901881..2912318
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9777_RS14545 sinI 2902264..2902437 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  D9777_RS14550 sinR 2902471..2902806 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  D9777_RS14555 - 2902854..2903639 (-) 786 WP_007408329.1 TasA family protein -
  D9777_RS14560 - 2903704..2904288 (-) 585 WP_012117977.1 signal peptidase I -
  D9777_RS14565 tapA 2904260..2904931 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  D9777_RS14570 - 2905190..2905519 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  D9777_RS14575 - 2905560..2905739 (-) 180 WP_003153093.1 YqzE family protein -
  D9777_RS14580 comGG 2905796..2906173 (-) 378 WP_021494310.1 competence type IV pilus minor pilin ComGG Machinery gene
  D9777_RS14585 comGF 2906174..2906569 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  D9777_RS14590 comGE 2906583..2906897 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  D9777_RS14595 comGD 2906881..2907318 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  D9777_RS14600 comGC 2907308..2907574 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  D9777_RS14605 comGB 2907621..2908658 (-) 1038 WP_021494313.1 competence type IV pilus assembly protein ComGB Machinery gene
  D9777_RS14610 comGA 2908645..2909715 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  D9777_RS14615 - 2909908..2910858 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  D9777_RS14620 - 2911004..2912305 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=320944 D9777_RS14595 WP_007612572.1 2906881..2907318(-) (comGD) [Bacillus velezensis strain Bac57]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=320944 D9777_RS14595 WP_007612572.1 2906881..2907318(-) (comGD) [Bacillus velezensis strain Bac57]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment