Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9777_RS14545 | Genome accession | NZ_CP033054 |
| Coordinates | 2902264..2902437 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain Bac57 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2897264..2907437
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9777_RS14530 | gcvT | 2898077..2899177 (-) | 1101 | WP_021494308.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9777_RS14535 | - | 2899601..2901271 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| D9777_RS14540 | - | 2901293..2902087 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| D9777_RS14545 | sinI | 2902264..2902437 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| D9777_RS14550 | sinR | 2902471..2902806 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| D9777_RS14555 | - | 2902854..2903639 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| D9777_RS14560 | - | 2903704..2904288 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| D9777_RS14565 | tapA | 2904260..2904931 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9777_RS14570 | - | 2905190..2905519 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| D9777_RS14575 | - | 2905560..2905739 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| D9777_RS14580 | comGG | 2905796..2906173 (-) | 378 | WP_021494310.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| D9777_RS14585 | comGF | 2906174..2906569 (-) | 396 | WP_021494311.1 | competence type IV pilus minor pilin ComGF | - |
| D9777_RS14590 | comGE | 2906583..2906897 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| D9777_RS14595 | comGD | 2906881..2907318 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=320940 D9777_RS14545 WP_014418369.1 2902264..2902437(+) (sinI) [Bacillus velezensis strain Bac57]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=320940 D9777_RS14545 WP_014418369.1 2902264..2902437(+) (sinI) [Bacillus velezensis strain Bac57]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |