Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   D9777_RS14545 Genome accession   NZ_CP033054
Coordinates   2902264..2902437 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain Bac57     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2897264..2907437
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9777_RS14530 gcvT 2898077..2899177 (-) 1101 WP_021494308.1 glycine cleavage system aminomethyltransferase GcvT -
  D9777_RS14535 - 2899601..2901271 (+) 1671 WP_021494309.1 SNF2-related protein -
  D9777_RS14540 - 2901293..2902087 (+) 795 WP_014418368.1 YqhG family protein -
  D9777_RS14545 sinI 2902264..2902437 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  D9777_RS14550 sinR 2902471..2902806 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  D9777_RS14555 - 2902854..2903639 (-) 786 WP_007408329.1 TasA family protein -
  D9777_RS14560 - 2903704..2904288 (-) 585 WP_012117977.1 signal peptidase I -
  D9777_RS14565 tapA 2904260..2904931 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  D9777_RS14570 - 2905190..2905519 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  D9777_RS14575 - 2905560..2905739 (-) 180 WP_003153093.1 YqzE family protein -
  D9777_RS14580 comGG 2905796..2906173 (-) 378 WP_021494310.1 competence type IV pilus minor pilin ComGG Machinery gene
  D9777_RS14585 comGF 2906174..2906569 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  D9777_RS14590 comGE 2906583..2906897 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  D9777_RS14595 comGD 2906881..2907318 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=320940 D9777_RS14545 WP_014418369.1 2902264..2902437(+) (sinI) [Bacillus velezensis strain Bac57]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=320940 D9777_RS14545 WP_014418369.1 2902264..2902437(+) (sinI) [Bacillus velezensis strain Bac57]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment