Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D9779_RS16220 Genome accession   NZ_CP033052
Coordinates   3120684..3120824 (-) Length   46 a.a.
NCBI ID   WP_121643190.1    Uniprot ID   -
Organism   Bacillus vallismortis strain Bac111     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3115684..3125824
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9779_RS16195 - 3116007..3116387 (-) 381 WP_121643189.1 hotdog fold thioesterase -
  D9779_RS16200 comA 3116406..3117050 (-) 645 WP_010329906.1 two-component system response regulator ComA Regulator
  D9779_RS16205 comP 3117131..3119449 (-) 2319 WP_010329907.1 sensor histidine kinase Regulator
  D9779_RS16210 comX 3119469..3119645 (-) 177 WP_010329908.1 competence pheromone ComX -
  D9779_RS16215 - 3119660..3120553 (-) 894 WP_240467595.1 polyprenyl synthetase family protein -
  D9779_RS16220 degQ 3120684..3120824 (-) 141 WP_121643190.1 degradation enzyme regulation protein DegQ Regulator
  D9779_RS16225 - 3121046..3121171 (+) 126 WP_121643768.1 hypothetical protein -
  D9779_RS16230 - 3121284..3121649 (+) 366 WP_121643191.1 hypothetical protein -
  D9779_RS16235 pdeH 3121628..3122857 (-) 1230 WP_121643192.1 cyclic di-GMP phosphodiesterase -
  D9779_RS16240 - 3122990..3124462 (-) 1473 WP_010329913.1 nicotinate phosphoribosyltransferase -
  D9779_RS16245 - 3124478..3125029 (-) 552 WP_010329914.1 cysteine hydrolase family protein -
  D9779_RS16250 - 3125126..3125524 (-) 399 WP_121643193.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5574.41 Da        Isoelectric Point: 4.9432

>NTDB_id=320885 D9779_RS16220 WP_121643190.1 3120684..3120824(-) (degQ) [Bacillus vallismortis strain Bac111]
MEQKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDRYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=320885 D9779_RS16220 WP_121643190.1 3120684..3120824(-) (degQ) [Bacillus vallismortis strain Bac111]
ATGGAACAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGACATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATCGATCAGCTCGATAGATACAATTATGCTATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.652

100

0.957

Multiple sequence alignment