Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   D9779_RS03015 Genome accession   NZ_CP033052
Coordinates   585986..586108 (+) Length   40 a.a.
NCBI ID   WP_010330797.1    Uniprot ID   A0AAP3CHT3
Organism   Bacillus vallismortis strain Bac111     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 580986..591108
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9779_RS03000 yclJ 582605..583288 (+) 684 WP_010330794.1 two-component system response regulator YclJ -
  D9779_RS03005 - 583275..584690 (+) 1416 WP_082246392.1 sensor histidine kinase -
  D9779_RS03010 rapC 584854..586002 (+) 1149 WP_121641890.1 response regulator aspartate phosphatase RapC Regulator
  D9779_RS03015 phrC 585986..586108 (+) 123 WP_010330797.1 phosphatase RapC inhibitor PhrC Regulator
  D9779_RS03020 - 586206..586301 (-) 96 WP_026014550.1 YjcZ family sporulation protein -
  D9779_RS03025 - 586438..586551 (-) 114 WP_039075856.1 YjcZ family sporulation protein -
  D9779_RS03030 - 586704..588068 (-) 1365 WP_121641891.1 aspartate kinase -
  D9779_RS03035 ceuB 588456..589406 (+) 951 WP_121641892.1 petrobactin ABC transporter permease YclN Machinery gene
  D9779_RS03040 yclO 589399..590346 (+) 948 WP_010330801.1 petrobactin ABC transporter permease YclO -
  D9779_RS03045 yclP 590340..591098 (+) 759 WP_010330802.1 petrobactin ABC transporter ATP-binding protein YclP -

Sequence

Protein


Download         Length: 40 a.a.        Molecular weight: 4151.91 Da        Isoelectric Point: 8.0285

>NTDB_id=320835 D9779_RS03015 WP_010330797.1 585986..586108(+) (phrC) [Bacillus vallismortis strain Bac111]
MKLKSKLFVICLAAAAIFTAAGVSANAEAPDFHVAERGMT

Nucleotide


Download         Length: 123 bp        

>NTDB_id=320835 D9779_RS03015 WP_010330797.1 585986..586108(+) (phrC) [Bacillus vallismortis strain Bac111]
ATGAAATTGAAATCTAAGTTGTTTGTTATTTGTTTAGCCGCAGCTGCGATTTTTACAGCAGCCGGCGTCTCTGCTAACGC
GGAAGCACCCGACTTTCATGTGGCGGAAAGAGGAATGACATAA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-40)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

95

100

0.95

Multiple sequence alignment