Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4H71_RS07310 Genome accession   NZ_CP032910
Coordinates   1481941..1482054 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 20-A-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1476941..1487054
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4H71_RS07290 - 1477584..1479002 (-) 1419 WP_139548595.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4H71_RS07295 comB10 1479072..1480208 (-) 1137 WP_139548596.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4H71_RS07300 - 1480201..1481201 (-) 1001 Protein_1385 TrbG/VirB9 family P-type conjugative transfer protein -
  D4H71_RS07305 comB8 1481201..1481944 (-) 744 WP_139548597.1 virB8 family protein Machinery gene
  D4H71_RS07310 comB7 1481941..1482054 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4H71_RS07315 comB6 1482070..1483125 (-) 1056 WP_139548697.1 P-type conjugative transfer protein TrbL Machinery gene
  D4H71_RS07320 - 1483133..1484128 (-) 996 WP_139548698.1 PDZ domain-containing protein -
  D4H71_RS07325 - 1484128..1484421 (-) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  D4H71_RS07330 panD 1484424..1484777 (-) 354 WP_000142243.1 aspartate 1-decarboxylase -
  D4H71_RS07335 - 1484767..1486992 (-) 2226 WP_139548598.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=320297 D4H71_RS07310 WP_001217873.1 1481941..1482054(-) (comB7) [Helicobacter pylori strain 20-A-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=320297 D4H71_RS07310 WP_001217873.1 1481941..1482054(-) (comB7) [Helicobacter pylori strain 20-A-EK1]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment