Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4I01_RS06985 Genome accession   NZ_CP032909
Coordinates   1420177..1420290 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 21-A-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1415177..1425290
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4I01_RS06965 - 1415845..1417257 (-) 1413 WP_139543446.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4I01_RS06970 comB10 1417328..1418464 (-) 1137 WP_139543447.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4I01_RS06975 comB9 1418457..1419437 (-) 981 WP_139543448.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4I01_RS06980 comB8 1419437..1420180 (-) 744 WP_001208388.1 virB8 family protein Machinery gene
  D4I01_RS06985 comB7 1420177..1420290 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4I01_RS06990 comB6 1420306..1421361 (-) 1056 WP_139543449.1 P-type conjugative transfer protein TrbL Machinery gene
  D4I01_RS06995 - 1421369..1422364 (-) 996 WP_139543450.1 PDZ domain-containing protein -
  D4I01_RS07000 - 1422364..1422665 (-) 302 Protein_1326 YbaB/EbfC family nucleoid-associated protein -
  D4I01_RS07005 panD 1422668..1423021 (-) 354 WP_139543451.1 aspartate 1-decarboxylase -
  D4I01_RS07010 - 1423011..1425236 (-) 2226 WP_139543452.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=320277 D4I01_RS06985 WP_001217873.1 1420177..1420290(-) (comB7) [Helicobacter pylori strain 21-A-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=320277 D4I01_RS06985 WP_001217873.1 1420177..1420290(-) (comB7) [Helicobacter pylori strain 21-A-EK1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment