Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4I31_RS00985 Genome accession   NZ_CP032908
Coordinates   204430..204543 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 23-A-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 199430..209543
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4I31_RS00960 - 199492..201717 (+) 2226 WP_139534050.1 ATP-dependent Clp protease ATP-binding subunit -
  D4I31_RS00965 panD 201707..202060 (+) 354 WP_139534051.1 aspartate 1-decarboxylase -
  D4I31_RS00970 - 202063..202356 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4I31_RS00975 - 202356..203351 (+) 996 WP_139535258.1 PDZ domain-containing protein -
  D4I31_RS00980 comB6 203359..204414 (+) 1056 WP_139535257.1 P-type conjugative transfer protein TrbL Machinery gene
  D4I31_RS00985 comB7 204430..204543 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4I31_RS00990 comB8 204540..205283 (+) 744 WP_139534052.1 virB8 family protein Machinery gene
  D4I31_RS00995 comB9 205283..206269 (+) 987 WP_139534053.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4I31_RS01000 comB10 206262..207398 (+) 1137 WP_139534054.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4I31_RS01005 - 207467..208879 (+) 1413 WP_139534055.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=320246 D4I31_RS00985 WP_001217873.1 204430..204543(+) (comB7) [Helicobacter pylori strain 23-A-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=320246 D4I31_RS00985 WP_001217873.1 204430..204543(+) (comB7) [Helicobacter pylori strain 23-A-EK1]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment