Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4K63_RS07330 Genome accession   NZ_CP032901
Coordinates   1483115..1483228 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 381-A-EK4     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1478115..1488228
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4K63_RS07310 - 1478784..1480196 (-) 1413 WP_139532720.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4K63_RS07315 comB10 1480266..1481402 (-) 1137 WP_139532722.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4K63_RS07320 comB9 1481395..1482381 (-) 987 WP_139532724.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4K63_RS07325 comB8 1482381..1483118 (-) 738 WP_139532725.1 virB8 family protein Machinery gene
  D4K63_RS07330 comB7 1483115..1483228 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4K63_RS07335 comB6 1483244..1484299 (-) 1056 WP_139532727.1 P-type conjugative transfer protein TrbL Machinery gene
  D4K63_RS07340 - 1484307..1485302 (-) 996 WP_139532911.1 PDZ domain-containing protein -
  D4K63_RS07345 - 1485302..1485595 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4K63_RS07350 panD 1485606..1485956 (-) 351 WP_000142242.1 aspartate 1-decarboxylase -
  D4K63_RS07355 - 1485946..1488171 (-) 2226 WP_139532729.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=320109 D4K63_RS07330 WP_001217873.1 1483115..1483228(-) (comB7) [Helicobacter pylori strain 381-A-EK4]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=320109 D4K63_RS07330 WP_001217873.1 1483115..1483228(-) (comB7) [Helicobacter pylori strain 381-A-EK4]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment