Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4K94_RS07585 Genome accession   NZ_CP032900
Coordinates   1540495..1540608 (-) Length   37 a.a.
NCBI ID   WP_139546586.1    Uniprot ID   -
Organism   Helicobacter pylori strain 476-A-EK5     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1535495..1545608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4K94_RS07565 - 1536161..1537579 (-) 1419 WP_139546583.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4K94_RS07570 comB10 1537649..1538785 (-) 1137 WP_139546584.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4K94_RS07575 comB9 1538778..1539761 (-) 984 WP_139546585.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4K94_RS07580 comB8 1539761..1540498 (-) 738 WP_108297487.1 virB8 family protein Machinery gene
  D4K94_RS07585 comB7 1540495..1540608 (-) 114 WP_139546586.1 comB7 lipoprotein Machinery gene
  D4K94_RS07590 comB6 1540624..1541679 (-) 1056 WP_139546619.1 P-type conjugative transfer protein TrbL Machinery gene
  D4K94_RS07595 - 1541687..1542682 (-) 996 WP_139546620.1 PDZ domain-containing protein -
  D4K94_RS07600 - 1542682..1542975 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4K94_RS07605 panD 1542978..1543331 (-) 354 WP_139542481.1 aspartate 1-decarboxylase -
  D4K94_RS07610 - 1543321..1545546 (-) 2226 WP_139546587.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4353.30 Da        Isoelectric Point: 9.3572

>NTDB_id=320088 D4K94_RS07585 WP_139546586.1 1540495..1540608(-) (comB7) [Helicobacter pylori strain 476-A-EK5]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLV

Nucleotide


Download         Length: 114 bp        

>NTDB_id=320088 D4K94_RS07585 WP_139546586.1 1540495..1540608(-) (comB7) [Helicobacter pylori strain 476-A-EK5]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGTATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973

Multiple sequence alignment