Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D9C14_RS03175 Genome accession   NZ_CP032860
Coordinates   584594..584734 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain SSJ-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 579594..589734
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C14_RS03150 (D9C14_03150) yuxO 579870..580250 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  D9C14_RS03155 (D9C14_03155) comA 580269..580913 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D9C14_RS03160 (D9C14_03160) comP 580994..583306 (-) 2313 WP_047183111.1 histidine kinase Regulator
  D9C14_RS03165 (D9C14_03165) comX 583322..583543 (-) 222 WP_014114983.1 competence pheromone ComX -
  D9C14_RS03170 (D9C14_03170) - 583540..584409 (-) 870 WP_015714626.1 polyprenyl synthetase family protein -
  D9C14_RS03175 (D9C14_03175) degQ 584594..584734 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D9C14_RS03180 (D9C14_03180) - 584956..585081 (+) 126 WP_121549029.1 hypothetical protein -
  D9C14_RS03185 (D9C14_03185) - 585196..585564 (+) 369 WP_038427878.1 hypothetical protein -
  D9C14_RS03190 (D9C14_03190) pdeH 585540..586769 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  D9C14_RS03195 (D9C14_03195) pncB 586906..588378 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  D9C14_RS03200 (D9C14_03200) pncA 588394..588945 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  D9C14_RS03205 (D9C14_03205) yueI 589042..589440 (-) 399 WP_019712929.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=319462 D9C14_RS03175 WP_003220708.1 584594..584734(-) (degQ) [Bacillus subtilis subsp. subtilis strain SSJ-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=319462 D9C14_RS03175 WP_003220708.1 584594..584734(-) (degQ) [Bacillus subtilis subsp. subtilis strain SSJ-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment