Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D9C11_RS05805 Genome accession   NZ_CP032855
Coordinates   1042631..1042771 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain PJ-7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1037631..1047771
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C11_RS05780 (D9C11_05780) yuxO 1037937..1038317 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  D9C11_RS05785 (D9C11_05785) comA 1038336..1038980 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D9C11_RS05790 (D9C11_05790) comP 1039061..1041373 (-) 2313 WP_121591110.1 two-component system sensor histidine kinase ComP Regulator
  D9C11_RS05795 (D9C11_05795) comX 1041392..1041559 (-) 168 WP_041057586.1 competence pheromone ComX Regulator
  D9C11_RS05800 (D9C11_05800) comQ 1041547..1042446 (-) 900 WP_038828674.1 class 1 isoprenoid biosynthesis enzyme Regulator
  D9C11_RS05805 (D9C11_05805) degQ 1042631..1042771 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D9C11_RS05810 (D9C11_05810) - 1042993..1043118 (+) 126 WP_003228793.1 hypothetical protein -
  D9C11_RS05815 (D9C11_05815) - 1043232..1043600 (+) 369 WP_014477834.1 hypothetical protein -
  D9C11_RS05820 (D9C11_05820) pdeH 1043576..1044805 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  D9C11_RS05825 (D9C11_05825) pncB 1044941..1046413 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  D9C11_RS05830 (D9C11_05830) pncA 1046429..1046980 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  D9C11_RS05835 (D9C11_05835) yueI 1047077..1047475 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=319322 D9C11_RS05805 WP_003220708.1 1042631..1042771(-) (degQ) [Bacillus subtilis subsp. subtilis strain PJ-7]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=319322 D9C11_RS05805 WP_003220708.1 1042631..1042771(-) (degQ) [Bacillus subtilis subsp. subtilis strain PJ-7]
ATGGAAAAGAAACTCGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment