Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   D9C11_RS05795 Genome accession   NZ_CP032855
Coordinates   1041392..1041559 (-) Length   55 a.a.
NCBI ID   WP_041057586.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain PJ-7     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 1036392..1046559
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C11_RS05765 (D9C11_05765) mrpE 1036780..1037256 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  D9C11_RS05770 (D9C11_05770) mrpF 1037256..1037540 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  D9C11_RS05775 (D9C11_05775) mnhG 1037524..1037898 (+) 375 WP_014477830.1 monovalent cation/H(+) antiporter subunit G -
  D9C11_RS05780 (D9C11_05780) yuxO 1037937..1038317 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  D9C11_RS05785 (D9C11_05785) comA 1038336..1038980 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D9C11_RS05790 (D9C11_05790) comP 1039061..1041373 (-) 2313 WP_121591110.1 two-component system sensor histidine kinase ComP Regulator
  D9C11_RS05795 (D9C11_05795) comX 1041392..1041559 (-) 168 WP_041057586.1 competence pheromone ComX Regulator
  D9C11_RS05800 (D9C11_05800) comQ 1041547..1042446 (-) 900 WP_038828674.1 class 1 isoprenoid biosynthesis enzyme Regulator
  D9C11_RS05805 (D9C11_05805) degQ 1042631..1042771 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D9C11_RS05810 (D9C11_05810) - 1042993..1043118 (+) 126 WP_003228793.1 hypothetical protein -
  D9C11_RS05815 (D9C11_05815) - 1043232..1043600 (+) 369 WP_014477834.1 hypothetical protein -
  D9C11_RS05820 (D9C11_05820) pdeH 1043576..1044805 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  D9C11_RS05825 (D9C11_05825) pncB 1044941..1046413 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6646.59 Da        Isoelectric Point: 4.9431

>NTDB_id=319320 D9C11_RS05795 WP_041057586.1 1041392..1041559(-) (comX) [Bacillus subtilis subsp. subtilis strain PJ-7]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYRADPITRQWKE

Nucleotide


Download         Length: 168 bp        

>NTDB_id=319320 D9C11_RS05795 WP_041057586.1 1041392..1041559(-) (comX) [Bacillus subtilis subsp. subtilis strain PJ-7]
GTGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATTGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTACAATGATTATTATCGGGCTGACCCAATAACTCGTCAATGGA
AAGAATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

94.545

100

0.945


Multiple sequence alignment