Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   D9C11_RS02045 Genome accession   NZ_CP032855
Coordinates   346280..346654 (-) Length   124 a.a.
NCBI ID   WP_032726157.1    Uniprot ID   A0AAP2PZF3
Organism   Bacillus subtilis subsp. subtilis strain PJ-7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 341280..351654
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C11_RS02005 (D9C11_02005) sinR 341387..341722 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C11_RS02010 (D9C11_02010) tasA 341815..342600 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  D9C11_RS02015 (D9C11_02015) sipW 342665..343237 (-) 573 WP_072557060.1 signal peptidase I SipW -
  D9C11_RS02020 (D9C11_02020) - 343221..343493 (-) 273 Protein_402 amyloid fiber anchoring/assembly protein TapA -
  D9C11_RS02025 (D9C11_02025) - 343631..344755 (+) 1125 WP_014478926.1 IS4-like element IS4Bsu1 family transposase -
  D9C11_RS02030 (D9C11_02030) tapA 344900..345391 (-) 492 Protein_404 amyloid fiber anchoring/assembly protein TapA -
  D9C11_RS02035 (D9C11_02035) yqzG 345662..345988 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  D9C11_RS02040 (D9C11_02040) spoIITA 346030..346209 (-) 180 WP_014480252.1 YqzE family protein -
  D9C11_RS02045 (D9C11_02045) comGG 346280..346654 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  D9C11_RS02050 (D9C11_02050) comGF 346655..347035 (-) 381 WP_121590957.1 competence type IV pilus minor pilin ComGF Machinery gene
  D9C11_RS02055 (D9C11_02055) comGE 347061..347408 (-) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  D9C11_RS02060 (D9C11_02060) comGD 347392..347823 (-) 432 WP_017696194.1 competence type IV pilus minor pilin ComGD Machinery gene
  D9C11_RS02065 (D9C11_02065) comGC 347813..348109 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C11_RS02070 (D9C11_02070) comGB 348123..349160 (-) 1038 WP_121590958.1 competence type IV pilus assembly protein ComGB Machinery gene
  D9C11_RS02075 (D9C11_02075) comGA 349147..350217 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  D9C11_RS02085 (D9C11_02085) corA 350626..351578 (-) 953 Protein_414 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14510.75 Da        Isoelectric Point: 9.7778

>NTDB_id=319299 D9C11_RS02045 WP_032726157.1 346280..346654(-) (comGG) [Bacillus subtilis subsp. subtilis strain PJ-7]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=319299 D9C11_RS02045 WP_032726157.1 346280..346654(-) (comGG) [Bacillus subtilis subsp. subtilis strain PJ-7]
ATGTACCGTACGAGGGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGAAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96


Multiple sequence alignment