Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   D9C09_RS16840 Genome accession   NZ_CP032852
Coordinates   3153736..3154119 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain GFR-12     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3148736..3159119
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C09_RS16800 (D9C09_16800) sinI 3149670..3149843 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C09_RS16805 (D9C09_16805) sinR 3149877..3150212 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C09_RS16810 (D9C09_16810) tasA 3150305..3151090 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C09_RS16815 (D9C09_16815) sipW 3151154..3151726 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C09_RS16820 (D9C09_16820) tapA 3151710..3152471 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C09_RS16825 (D9C09_16825) yqzG 3152743..3153069 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C09_RS16830 (D9C09_16830) spoIITA 3153111..3153290 (-) 180 WP_014480252.1 YqzE family protein -
  D9C09_RS16835 (D9C09_16835) comGG 3153361..3153735 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C09_RS16840 (D9C09_16840) comGF 3153736..3154119 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  D9C09_RS16845 (D9C09_16845) comGE 3154145..3154492 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C09_RS16850 (D9C09_16850) comGD 3154476..3154907 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C09_RS16855 (D9C09_16855) comGC 3154897..3155193 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C09_RS16860 (D9C09_16860) comGB 3155207..3156244 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C09_RS16865 (D9C09_16865) comGA 3156231..3157301 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C09_RS16870 (D9C09_16870) - 3157513..3157710 (-) 198 WP_014480259.1 CBS domain-containing protein -
  D9C09_RS16875 (D9C09_16875) corA 3157712..3158665 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=319190 D9C09_RS16840 WP_029317913.1 3153736..3154119(-) (comGF) [Bacillus subtilis subsp. subtilis strain GFR-12]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=319190 D9C09_RS16840 WP_029317913.1 3153736..3154119(-) (comGF) [Bacillus subtilis subsp. subtilis strain GFR-12]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment