Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   D9C09_RS16800 Genome accession   NZ_CP032852
Coordinates   3149670..3149843 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain GFR-12     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3144670..3154843
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C09_RS16785 (D9C09_16785) gcvT 3145470..3146558 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  D9C09_RS16790 (D9C09_16790) hepAA 3146999..3148672 (+) 1674 WP_038829735.1 SNF2-related protein -
  D9C09_RS16795 (D9C09_16795) yqhG 3148693..3149487 (+) 795 WP_014480249.1 YqhG family protein -
  D9C09_RS16800 (D9C09_16800) sinI 3149670..3149843 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C09_RS16805 (D9C09_16805) sinR 3149877..3150212 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C09_RS16810 (D9C09_16810) tasA 3150305..3151090 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C09_RS16815 (D9C09_16815) sipW 3151154..3151726 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C09_RS16820 (D9C09_16820) tapA 3151710..3152471 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C09_RS16825 (D9C09_16825) yqzG 3152743..3153069 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C09_RS16830 (D9C09_16830) spoIITA 3153111..3153290 (-) 180 WP_014480252.1 YqzE family protein -
  D9C09_RS16835 (D9C09_16835) comGG 3153361..3153735 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C09_RS16840 (D9C09_16840) comGF 3153736..3154119 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  D9C09_RS16845 (D9C09_16845) comGE 3154145..3154492 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=319187 D9C09_RS16800 WP_003230187.1 3149670..3149843(+) (sinI) [Bacillus subtilis subsp. subtilis strain GFR-12]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=319187 D9C09_RS16800 WP_003230187.1 3149670..3149843(+) (sinI) [Bacillus subtilis subsp. subtilis strain GFR-12]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment