Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D2M30_RS15690 Genome accession   NZ_CP032146
Coordinates   3080035..3080175 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain YP6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3075035..3085175
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D2M30_RS15665 (D2M30_15680) - 3075375..3075758 (-) 384 WP_045509485.1 hotdog fold thioesterase -
  D2M30_RS15670 (D2M30_15685) comA 3075780..3076424 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  D2M30_RS15675 (D2M30_15690) comP 3076505..3078796 (-) 2292 WP_088613350.1 histidine kinase Regulator
  D2M30_RS15680 (D2M30_15695) comX 3078808..3078972 (-) 165 WP_007613432.1 competence pheromone ComX -
  D2M30_RS15685 (D2M30_15700) - 3078972..3079883 (-) 912 WP_125123647.1 polyprenyl synthetase family protein -
  D2M30_RS15690 (D2M30_15705) degQ 3080035..3080175 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  D2M30_RS15700 (D2M30_15715) - 3080640..3080981 (+) 342 WP_045509476.1 hypothetical protein -
  D2M30_RS15705 (D2M30_15720) - 3080988..3082211 (-) 1224 WP_013353400.1 EAL and HDOD domain-containing protein -
  D2M30_RS15710 (D2M30_15725) - 3082341..3083807 (-) 1467 WP_125123168.1 nicotinate phosphoribosyltransferase -
  D2M30_RS15715 (D2M30_15730) - 3083825..3084376 (-) 552 WP_045509472.1 cysteine hydrolase family protein -
  D2M30_RS15720 (D2M30_15735) - 3084456..3084851 (-) 396 WP_125123169.1 YueI family protein -
  D2M30_RS15725 (D2M30_15740) - 3084917..3085165 (-) 249 WP_125123170.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=314047 D2M30_RS15690 WP_013353398.1 3080035..3080175(-) (degQ) [Bacillus amyloliquefaciens strain YP6]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=314047 D2M30_RS15690 WP_013353398.1 3080035..3080175(-) (degQ) [Bacillus amyloliquefaciens strain YP6]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913

Multiple sequence alignment