Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   D2M30_RS01960 Genome accession   NZ_CP032146
Coordinates   381894..382013 (+) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0AAP7N4M9
Organism   Bacillus amyloliquefaciens strain YP6     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 376894..387013
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D2M30_RS01945 (D2M30_01950) - 378506..379189 (+) 684 WP_013351002.1 response regulator transcription factor -
  D2M30_RS01950 (D2M30_01955) - 379176..380603 (+) 1428 WP_171866174.1 HAMP domain-containing sensor histidine kinase -
  D2M30_RS01955 (D2M30_01960) rapC 380762..381910 (+) 1149 WP_065980700.1 tetratricopeptide repeat protein Regulator
  D2M30_RS01960 (D2M30_01965) phrC 381894..382013 (+) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  D2M30_RS01965 (D2M30_01970) - 382161..382262 (-) 102 WP_013351006.1 YjcZ family sporulation protein -
  D2M30_RS01970 (D2M30_01975) - 382357..383721 (-) 1365 WP_125122049.1 aspartate kinase -
  D2M30_RS01975 (D2M30_01980) ceuB 384135..385088 (+) 954 WP_013351008.1 ABC transporter permease Machinery gene
  D2M30_RS01980 (D2M30_01985) - 385078..386025 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  D2M30_RS01985 (D2M30_01990) - 386019..386777 (+) 759 WP_013351009.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=313995 D2M30_RS01960 WP_013351005.1 381894..382013(+) (phrC) [Bacillus amyloliquefaciens strain YP6]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=313995 D2M30_RS01960 WP_013351005.1 381894..382013(+) (phrC) [Bacillus amyloliquefaciens strain YP6]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821


Multiple sequence alignment