Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D3C60_RS11870 | Genome accession | NZ_CP032144 |
| Coordinates | 2446704..2446877 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain BIM B-439D | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2441704..2451877
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D3C60_RS11855 (D3C60_11855) | gcvT | 2442517..2443617 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D3C60_RS11860 (D3C60_11860) | - | 2444041..2445711 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| D3C60_RS11865 (D3C60_11865) | - | 2445733..2446527 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| D3C60_RS11870 (D3C60_11870) | sinI | 2446704..2446877 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| D3C60_RS11875 (D3C60_11875) | sinR | 2446911..2447246 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| D3C60_RS11880 (D3C60_11880) | - | 2447294..2448079 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| D3C60_RS11885 (D3C60_11885) | - | 2448144..2448728 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| D3C60_RS11890 (D3C60_11890) | tapA | 2448700..2449371 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D3C60_RS11895 (D3C60_11895) | - | 2449630..2449959 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| D3C60_RS11900 (D3C60_11900) | - | 2449999..2450178 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| D3C60_RS11905 (D3C60_11905) | comGG | 2450235..2450612 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| D3C60_RS11910 (D3C60_11910) | comGF | 2450613..2451113 (-) | 501 | WP_257645080.1 | competence type IV pilus minor pilin ComGF | - |
| D3C60_RS11915 (D3C60_11915) | comGE | 2451022..2451336 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| D3C60_RS11920 (D3C60_11920) | comGD | 2451320..2451757 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=313926 D3C60_RS11870 WP_003153105.1 2446704..2446877(+) (sinI) [Bacillus velezensis strain BIM B-439D]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=313926 D3C60_RS11870 WP_003153105.1 2446704..2446877(+) (sinI) [Bacillus velezensis strain BIM B-439D]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |