Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D0819_RS11730 Genome accession   NZ_CP031784
Coordinates   2232174..2232314 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain HMNig-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2227174..2237314
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D0819_RS11705 (D0819_11740) yuxO 2227482..2227862 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  D0819_RS11710 (D0819_11745) comA 2227881..2228525 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D0819_RS11715 (D0819_11750) comP 2228606..2230917 (-) 2312 Protein_2312 two-component system sensor histidine kinase ComP -
  D0819_RS11720 (D0819_11755) comX 2230934..2231107 (-) 174 WP_021480497.1 competence pheromone ComX -
  D0819_RS11725 (D0819_11760) comQ 2231123..2231989 (-) 867 WP_021480498.1 polyprenyl synthetase family protein Regulator
  D0819_RS11730 (D0819_11765) degQ 2232174..2232314 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D0819_RS21725 - 2232536..2232598 (+) 63 Protein_2316 hypothetical protein -
  D0819_RS11735 (D0819_11770) - 2232776..2233144 (+) 369 WP_038828672.1 hypothetical protein -
  D0819_RS11740 (D0819_11775) pdeH 2233120..2234349 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  D0819_RS11745 (D0819_11780) pncB 2234486..2235958 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  D0819_RS11750 (D0819_11785) pncA 2235974..2236525 (-) 552 WP_021480500.1 isochorismatase family cysteine hydrolase -
  D0819_RS11755 (D0819_11790) yueI 2236622..2237020 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=311395 D0819_RS11730 WP_003220708.1 2232174..2232314(-) (degQ) [Bacillus subtilis strain HMNig-2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=311395 D0819_RS11730 WP_003220708.1 2232174..2232314(-) (degQ) [Bacillus subtilis strain HMNig-2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment