Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DXY21_RS12270 | Genome accession | NZ_CP031694 |
| Coordinates | 2391448..2391621 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SRCM101368 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2386448..2396621
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXY21_RS12220 (DXY21_02437) | comGD | 2386569..2387006 (+) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| DXY21_RS12225 (DXY21_02438) | comGE | 2386990..2387304 (+) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| DXY21_RS12230 (DXY21_02439) | comGF | 2387318..2387713 (+) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| DXY21_RS12235 (DXY21_02440) | comGG | 2387714..2388091 (+) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| DXY21_RS12240 (DXY21_02441) | - | 2388148..2388327 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| DXY21_RS12245 (DXY21_02442) | - | 2388367..2388696 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| DXY21_RS12250 (DXY21_02443) | tapA | 2388955..2389626 (+) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DXY21_RS12255 (DXY21_02444) | sipW | 2389598..2390182 (+) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| DXY21_RS12260 (DXY21_02445) | tasA | 2390246..2391031 (+) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| DXY21_RS12265 (DXY21_02446) | sinR | 2391079..2391414 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| DXY21_RS12270 (DXY21_02447) | sinI | 2391448..2391621 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| DXY21_RS12275 (DXY21_02448) | - | 2391798..2392592 (-) | 795 | WP_003153106.1 | YqhG family protein | - |
| DXY21_RS12280 (DXY21_02449) | - | 2392610..2394280 (-) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| DXY21_RS12285 (DXY21_02450) | gcvT | 2394704..2395804 (+) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=310415 DXY21_RS12270 WP_003153105.1 2391448..2391621(-) (sinI) [Bacillus velezensis strain SRCM101368]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=310415 DXY21_RS12270 WP_003153105.1 2391448..2391621(-) (sinI) [Bacillus velezensis strain SRCM101368]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |