Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   DXY21_RS12215 Genome accession   NZ_CP031694
Coordinates   2386313..2386579 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM101368     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2381313..2391579
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXY21_RS12195 (DXY21_02432) - 2381583..2382884 (-) 1302 WP_014305416.1 hemolysin family protein -
  DXY21_RS12200 (DXY21_02433) - 2383030..2383980 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  DXY21_RS12205 (DXY21_02434) comGA 2384172..2385242 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  DXY21_RS12210 (DXY21_02435) comGB 2385229..2386266 (+) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  DXY21_RS12215 (DXY21_02436) comGC 2386313..2386579 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  DXY21_RS12220 (DXY21_02437) comGD 2386569..2387006 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  DXY21_RS12225 (DXY21_02438) comGE 2386990..2387304 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  DXY21_RS12230 (DXY21_02439) comGF 2387318..2387713 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  DXY21_RS12235 (DXY21_02440) comGG 2387714..2388091 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  DXY21_RS12240 (DXY21_02441) - 2388148..2388327 (+) 180 WP_003153093.1 YqzE family protein -
  DXY21_RS12245 (DXY21_02442) - 2388367..2388696 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DXY21_RS12250 (DXY21_02443) tapA 2388955..2389626 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  DXY21_RS12255 (DXY21_02444) sipW 2389598..2390182 (+) 585 WP_003153100.1 signal peptidase I SipW -
  DXY21_RS12260 (DXY21_02445) tasA 2390246..2391031 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  DXY21_RS12265 (DXY21_02446) sinR 2391079..2391414 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=310411 DXY21_RS12215 WP_042635730.1 2386313..2386579(+) (comGC) [Bacillus velezensis strain SRCM101368]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=310411 DXY21_RS12215 WP_042635730.1 2386313..2386579(+) (comGC) [Bacillus velezensis strain SRCM101368]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment