Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   DNJ55_RS01360 Genome accession   NZ_CP031604
Coordinates   274408..274869 (+) Length   153 a.a.
NCBI ID   WP_037542875.1    Uniprot ID   -
Organism   Staphylococcus pseudintermedius strain AI14     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 225385..279851 274408..274869 within 0


Gene organization within MGE regions


Location: 225385..279851
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DNJ55_RS01075 (DNJ55_01070) - 225529..226281 (+) 753 WP_014613779.1 16S rRNA (uracil(1498)-N(3))-methyltransferase -
  DNJ55_RS01080 (DNJ55_01075) mtaB 226286..227635 (+) 1350 WP_015729250.1 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB -
  DNJ55_RS01085 (DNJ55_01080) rpsU 227844..228020 (+) 177 WP_002471046.1 30S ribosomal protein S21 -
  DNJ55_RS12990 - 228326..229339 (+) 1014 WP_265478592.1 hypothetical protein -
  DNJ55_RS01095 (DNJ55_01090) - 229724..230374 (+) 651 WP_015729248.1 NfeD family protein -
  DNJ55_RS01100 (DNJ55_01095) floA 230393..231388 (+) 996 WP_014613783.1 flotillin-like protein FloA -
  DNJ55_RS01105 (DNJ55_01100) - 231402..232016 (+) 615 WP_014613784.1 hypothetical protein -
  DNJ55_RS01110 (DNJ55_01105) - 232367..233311 (+) 945 WP_014613785.1 PhoH family protein -
  DNJ55_RS01115 (DNJ55_01110) ybeY 233315..233776 (+) 462 WP_014613786.1 rRNA maturation RNase YbeY -
  DNJ55_RS01120 (DNJ55_01115) - 233776..234123 (+) 348 WP_014613787.1 diacylglycerol kinase family protein -
  DNJ55_RS01125 (DNJ55_01120) cdd 234139..234546 (+) 408 WP_014613788.1 cytidine deaminase -
  DNJ55_RS01130 (DNJ55_01125) era 234543..235439 (+) 897 WP_014613789.1 GTPase Era -
  DNJ55_RS01135 (DNJ55_01130) recO 235464..236234 (+) 771 WP_096538131.1 DNA repair protein RecO -
  DNJ55_RS01140 (DNJ55_01135) - 236450..237844 (-) 1395 WP_015729245.1 glycine--tRNA ligase -
  DNJ55_RS01145 (DNJ55_01140) - 238339..238959 (+) 621 WP_075773659.1 helix-turn-helix transcriptional regulator -
  DNJ55_RS01150 (DNJ55_01145) - 238974..239801 (+) 828 WP_014613793.1 pyruvate, water dikinase regulatory protein -
  DNJ55_RS01155 (DNJ55_01150) dnaG 239874..241661 (+) 1788 WP_014613794.1 DNA primase -
  DNJ55_RS01160 (DNJ55_01155) rpoD 241679..242788 (+) 1110 WP_014613795.1 RNA polymerase sigma factor RpoD -
  DNJ55_RS01165 (DNJ55_01160) - 243306..243983 (+) 678 WP_096538134.1 tRNA (adenine(22)-N(1))-methyltransferase -
  DNJ55_RS01170 (DNJ55_01165) - 243980..245083 (+) 1104 WP_037542857.1 Nif3-like dinuclear metal center hexameric protein -
  DNJ55_RS01175 (DNJ55_01170) - 245237..246205 (-) 969 WP_015729241.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  DNJ55_RS01180 (DNJ55_01175) - 246386..247720 (+) 1335 WP_014613799.1 DEAD/DEAH box helicase -
  DNJ55_RS01185 (DNJ55_01180) - 247746..248639 (+) 894 WP_015729240.1 deoxyribonuclease IV -
  DNJ55_RS01190 (DNJ55_01185) - 248824..249594 (+) 771 WP_014613801.1 metal ABC transporter ATP-binding protein -
  DNJ55_RS01195 (DNJ55_01190) - 249591..250478 (+) 888 WP_014613802.1 metal ABC transporter permease -
  DNJ55_RS01200 (DNJ55_01195) - 250441..250848 (+) 408 WP_014613803.1 Fur family transcriptional regulator -
  DNJ55_RS01205 (DNJ55_01200) ispG 251122..252228 (-) 1107 WP_014613804.1 flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase -
  DNJ55_RS01210 (DNJ55_01205) - 252575..253174 (+) 600 WP_014613806.1 superoxide dismutase -
  DNJ55_RS01215 (DNJ55_01210) - 253467..255506 (+) 2040 WP_096538136.1 peptidoglycan D,D-transpeptidase FtsI family protein -
  DNJ55_RS01220 (DNJ55_01215) - 255775..256734 (+) 960 WP_015729236.1 PstS family phosphate ABC transporter substrate-binding protein -
  DNJ55_RS01225 (DNJ55_01220) pstC 256852..257778 (+) 927 WP_096538138.1 phosphate ABC transporter permease subunit PstC -
  DNJ55_RS01230 (DNJ55_01225) pstA 257778..258659 (+) 882 WP_172426176.1 phosphate ABC transporter permease PstA -
  DNJ55_RS01235 (DNJ55_01230) pstB 258677..259519 (+) 843 WP_014613811.1 phosphate ABC transporter ATP-binding protein PstB -
  DNJ55_RS01240 (DNJ55_01235) phoU 259521..260171 (+) 651 WP_014613812.1 phosphate signaling complex protein PhoU -
  DNJ55_RS01245 (DNJ55_01240) rpmG 260243..260392 (+) 150 WP_014613813.1 50S ribosomal protein L33 -
  DNJ55_RS01250 (DNJ55_01245) - 260544..261083 (+) 540 WP_014613814.1 5-formyltetrahydrofolate cyclo-ligase -
  DNJ55_RS01255 (DNJ55_01250) - 261102..262541 (+) 1440 WP_100007251.1 rhomboid family intramembrane serine protease -
  DNJ55_RS01260 (DNJ55_01255) - 262543..262746 (+) 204 WP_014613816.1 YqgQ family protein -
  DNJ55_RS01265 (DNJ55_01260) - 262743..263729 (+) 987 WP_014613817.1 ROK family glucokinase -
  DNJ55_RS01270 (DNJ55_01265) - 263730..264041 (+) 312 WP_014613818.1 MTH1187 family thiamine-binding protein -
  DNJ55_RS01275 (DNJ55_01270) - 264054..264683 (+) 630 WP_037542865.1 MBL fold metallo-hydrolase -
  DNJ55_RS01280 (DNJ55_01275) - 264844..265353 (+) 510 Protein_256 ATPase, T2SS/T4P/T4SS family -
  DNJ55_RS01285 (DNJ55_01280) - 265441..266664 (-) 1224 WP_037542866.1 tyrosine-type recombinase/integrase -
  DNJ55_RS01290 (DNJ55_01285) - 266725..267336 (-) 612 WP_100006941.1 hypothetical protein -
  DNJ55_RS01295 (DNJ55_01290) - 267383..267844 (-) 462 WP_015729225.1 ImmA/IrrE family metallo-endopeptidase -
  DNJ55_RS01300 (DNJ55_01295) - 267858..268169 (-) 312 WP_015729224.1 helix-turn-helix domain-containing protein -
  DNJ55_RS01305 (DNJ55_01300) - 268345..268572 (+) 228 WP_015729223.1 hypothetical protein -
  DNJ55_RS01310 (DNJ55_01305) - 268769..268951 (+) 183 WP_015729222.1 hypothetical protein -
  DNJ55_RS01315 (DNJ55_01310) - 268975..269466 (-) 492 WP_037544203.1 hypothetical protein -
  DNJ55_RS01320 (DNJ55_01315) - 269528..269791 (+) 264 WP_103866755.1 helix-turn-helix domain-containing protein -
  DNJ55_RS01325 - 269806..269982 (+) 177 WP_168434018.1 hypothetical protein -
  DNJ55_RS01330 (DNJ55_01320) - 269984..270280 (+) 297 WP_103866757.1 DUF2482 family protein -
  DNJ55_RS01335 (DNJ55_01325) - 270367..270624 (+) 258 WP_103866759.1 DUF1108 family protein -
  DNJ55_RS01340 (DNJ55_01330) - 270640..272586 (+) 1947 WP_190001148.1 AAA family ATPase -
  DNJ55_RS13440 (DNJ55_01335) - 272625..272780 (+) 156 WP_420903256.1 helix-turn-helix domain-containing protein -
  DNJ55_RS01350 (DNJ55_01340) - 272794..273708 (+) 915 WP_037542874.1 RecT family recombinase -
  DNJ55_RS01355 (DNJ55_01345) - 273771..274415 (+) 645 WP_081378287.1 MBL fold metallo-hydrolase -
  DNJ55_RS01360 (DNJ55_01350) ssb 274408..274869 (+) 462 WP_037542875.1 single-stranded DNA-binding protein Machinery gene
  DNJ55_RS01365 (DNJ55_01355) - 274884..275291 (+) 408 WP_037542877.1 hypothetical protein -
  DNJ55_RS01370 (DNJ55_01360) - 275307..276026 (+) 720 WP_103866762.1 hypothetical protein -
  DNJ55_RS01375 (DNJ55_01365) - 276078..276842 (+) 765 WP_190001149.1 DnaD domain-containing protein -
  DNJ55_RS01380 (DNJ55_01370) - 276857..277639 (+) 783 WP_103866766.1 ATP-binding protein -
  DNJ55_RS12995 - 277636..277803 (+) 168 WP_233510688.1 hypothetical protein -
  DNJ55_RS01385 (DNJ55_01380) - 278156..278407 (+) 252 WP_103866770.1 hypothetical protein -
  DNJ55_RS01390 (DNJ55_01385) - 278440..278661 (+) 222 WP_234985416.1 SAV1978 family virulence-associated passenger protein -
  DNJ55_RS01395 (DNJ55_01390) - 278639..278824 (+) 186 WP_103866772.1 hypothetical protein -
  DNJ55_RS01400 (DNJ55_01395) - 278821..279171 (+) 351 WP_103866774.1 YopX family protein -
  DNJ55_RS01405 (DNJ55_01400) - 279171..279566 (+) 396 WP_096636854.1 hypothetical protein -

Sequence


Protein


Download         Length: 153 a.a.        Molecular weight: 16792.71 Da        Isoelectric Point: 7.1063

>NTDB_id=307816 DNJ55_RS01360 WP_037542875.1 274408..274869(+) (ssb) [Staphylococcus pseudintermedius strain AI14]
MINRVVLVGRLTKNPELRHTQSGTSVCSFTLAVNRTFTNAQGEREADFINCIALKKTAENIINYLSKGSLAGVDGRLKSR
SYENKEGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKANHVAATSQNPFVNMNDSIDISDDDLPF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=307816 DNJ55_RS01360 WP_037542875.1 274408..274869(+) (ssb) [Staphylococcus pseudintermedius strain AI14]
ATGATTAATAGAGTTGTACTTGTAGGTCGATTAACTAAAAATCCTGAATTAAGACATACACAAAGCGGTACAAGTGTTTG
TAGTTTCACGCTTGCTGTAAATCGTACATTTACGAATGCGCAAGGGGAGCGTGAAGCGGATTTCATTAACTGTATTGCTT
TAAAAAAAACAGCAGAGAACATTATTAACTATTTGTCAAAAGGAAGTTTAGCAGGCGTTGATGGTCGTTTAAAATCACGC
AGTTACGAAAACAAAGAGGGACAACGCGTATATGTCACTGAGGTGATATGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAGCAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATATGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

55.882

100

0.621

  ssbA Bacillus subtilis subsp. subtilis str. 168

52.907

100

0.595

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

69.281

0.412


Multiple sequence alignment