Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   DS740_RS13310 Genome accession   NZ_CP030937
Coordinates   2550784..2550957 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. DM2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2545784..2555957
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DS740_RS13295 (DS740_13295) gcvT 2546584..2547672 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  DS740_RS13300 (DS740_13300) - 2548113..2549786 (+) 1674 WP_041850014.1 SNF2-related protein -
  DS740_RS13305 (DS740_13305) - 2549807..2550601 (+) 795 WP_003230200.1 YqhG family protein -
  DS740_RS13310 (DS740_13310) sinI 2550784..2550957 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  DS740_RS13315 (DS740_13315) sinR 2550991..2551326 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DS740_RS13320 (DS740_13320) tasA 2551419..2552204 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  DS740_RS13325 (DS740_13325) - 2552268..2552840 (-) 573 WP_003246088.1 signal peptidase I -
  DS740_RS13330 (DS740_13330) tapA 2552824..2553585 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  DS740_RS13335 (DS740_13335) - 2553857..2554183 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DS740_RS13340 (DS740_13340) - 2554225..2554404 (-) 180 WP_003230176.1 YqzE family protein -
  DS740_RS13345 (DS740_13345) comGG 2554475..2554849 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  DS740_RS13350 (DS740_13350) comGF 2554850..2555233 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  DS740_RS13355 (DS740_13355) comGE 2555259..2555606 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=302605 DS740_RS13310 WP_003230187.1 2550784..2550957(+) (sinI) [Bacillus sp. DM2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=302605 DS740_RS13310 WP_003230187.1 2550784..2550957(+) (sinI) [Bacillus sp. DM2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment