Detailed information
Overview
| Name | comE/blpR | Type | Regulator |
| Locus tag | ETT55_RS08915 | Genome accession | NZ_CP035444 |
| Coordinates | 414093..414227 (+) | Length | 44 a.a. |
| NCBI ID | WP_231870885.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm90.5 | ||
| Function | activate transcription of early competence genes; regulation of comX expression (predicted from homology) Competence regulation |
||
Genomic Context
Location: 409093..419227
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT55_RS02230 (ETT55_02230) | - | 410133..410708 (+) | 576 | WP_009880369.1 | uracil-DNA glycosylase family protein | - |
| ETT55_RS02235 (ETT55_02235) | ybeY | 410867..411364 (+) | 498 | WP_002985748.1 | rRNA maturation RNase YbeY | - |
| ETT55_RS02240 (ETT55_02240) | - | 411345..411752 (+) | 408 | WP_030126113.1 | diacylglycerol kinase family protein | - |
| ETT55_RS02245 (ETT55_02245) | era | 411872..412768 (+) | 897 | WP_002985743.1 | GTPase Era | - |
| ETT55_RS02250 (ETT55_02250) | - | 412789..413265 (+) | 477 | WP_002985741.1 | NUDIX hydrolase | - |
| ETT55_RS08910 (ETT55_02255) | - | 413571..413825 (-) | 255 | WP_111689649.1 | hypothetical protein | - |
| ETT55_RS08915 | comE/blpR | 414093..414227 (+) | 135 | WP_231870885.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | Regulator |
| ETT55_RS08920 | - | 414533..416115 (-) | 1583 | Protein_382 | ABC transporter transmembrane domain-containing protein | - |
| ETT55_RS02280 (ETT55_02280) | - | 416413..416637 (+) | 225 | WP_002994580.1 | Blp family class II bacteriocin | - |
| ETT55_RS08790 | - | 416615..416791 (+) | 177 | WP_002994581.1 | hypothetical protein | - |
| ETT55_RS09020 (ETT55_02285) | - | 417123..417467 (+) | 345 | Protein_385 | lysostaphin resistance A-like protein | - |
| ETT55_RS09025 | - | 417468..417518 (+) | 51 | Protein_386 | bacteriocin | - |
| ETT55_RS02295 (ETT55_02295) | - | 418008..418235 (+) | 228 | WP_136021753.1 | Blp family class II bacteriocin | - |
| ETT55_RS02300 (ETT55_02300) | - | 418284..418601 (+) | 318 | WP_002994587.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 44 a.a. Molecular weight: 5308.07 Da Isoelectric Point: 6.9714
>NTDB_id=302556 ETT55_RS08915 WP_231870885.1 414093..414227(+) (comE/blpR) [Streptococcus pyogenes strain emm90.5]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQ
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQ
Nucleotide
Download Length: 135 bp
>NTDB_id=302556 ETT55_RS08915 WP_231870885.1 414093..414227(+) (comE/blpR) [Streptococcus pyogenes strain emm90.5]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAATGA
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE/blpR | Streptococcus mutans UA159 |
62.791 |
97.727 |
0.614 |
| agrA | Staphylococcus aureus N315 |
45.455 |
100 |
0.455 |
| comE/comE1 | Streptococcus equinus JB1 |
41.463 |
93.182 |
0.386 |