Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   DR994_RS04135 Genome accession   NZ_CP030927
Coordinates   802284..803024 (-) Length   246 a.a.
NCBI ID   WP_173940476.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain CS9     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 747616..808691 802284..803024 within 0


Gene organization within MGE regions


Location: 747616..808691
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DR994_RS03855 (DR994_03980) - 747861..748064 (-) 204 WP_014727399.1 Mbeg1-like protein -
  DR994_RS09890 (DR994_03995) - 748347..748562 (-) 216 WP_311134764.1 Mbeg1-like protein -
  DR994_RS09895 - 748580..748762 (-) 183 WP_011680981.1 hypothetical protein -
  DR994_RS03870 (DR994_04000) - 748874..749500 (+) 627 WP_173940456.1 Pr6Pr family membrane protein -
  DR994_RS03875 (DR994_04005) - 749756..750145 (+) 390 WP_002948103.1 hypothetical protein -
  DR994_RS03880 (DR994_04010) - 750337..751284 (+) 948 WP_014608156.1 glycoside hydrolase family 25 protein -
  DR994_RS03885 (DR994_04015) - 751399..751872 (+) 474 WP_002950328.1 aminoacyl-tRNA deacylase -
  DR994_RS03890 (DR994_04020) - 751875..752513 (+) 639 WP_173940457.1 histidine phosphatase family protein -
  DR994_RS03895 (DR994_04030) - 752938..753840 (-) 903 WP_011225749.1 HAD family hydrolase -
  DR994_RS03900 (DR994_04035) - 754165..754644 (-) 480 WP_002952755.1 hypothetical protein -
  DR994_RS03905 (DR994_04040) - 754658..755936 (-) 1279 Protein_730 LysM peptidoglycan-binding domain-containing protein -
  DR994_RS03910 (DR994_04045) lysS 756065..757555 (+) 1491 WP_173940458.1 lysine--tRNA ligase -
  DR994_RS09900 - 757782..758009 (-) 228 WP_254596098.1 hypothetical protein -
  DR994_RS03915 (DR994_04050) - 758010..758690 (-) 681 WP_254596099.1 hypothetical protein -
  DR994_RS10240 - 758748..758870 (-) 123 WP_002886098.1 hypothetical protein -
  DR994_RS03920 (DR994_04055) - 758966..760600 (-) 1635 WP_173940459.1 ATP-binding protein -
  DR994_RS03925 (DR994_04060) - 760587..761951 (-) 1365 WP_173940460.1 SIR2 family protein -
  DR994_RS03930 (DR994_04065) - 761988..763478 (-) 1491 WP_173940710.1 Sau3AI family type II restriction endonuclease -
  DR994_RS03935 (DR994_04070) dcm 763596..764870 (+) 1275 WP_173940461.1 DNA (cytosine-5-)-methyltransferase -
  DR994_RS03940 (DR994_04075) - 764909..765217 (-) 309 WP_173940462.1 hypothetical protein -
  DR994_RS03945 (DR994_04080) - 765413..766750 (+) 1338 WP_022096788.1 Nramp family divalent metal transporter -
  DR994_RS03950 (DR994_04085) - 766785..766997 (-) 213 WP_002886106.1 YdbC family protein -
  DR994_RS03955 (DR994_04090) - 767123..767407 (+) 285 WP_173940463.1 hypothetical protein -
  DR994_RS03960 (DR994_04095) - 767502..768041 (+) 540 WP_173940464.1 biotin transporter BioY -
  DR994_RS03965 (DR994_04100) - 768092..768411 (-) 320 Protein_744 CHY zinc finger protein -
  DR994_RS03970 (DR994_04105) - 768411..769697 (-) 1287 WP_002945995.1 U32 family peptidase -
  DR994_RS03975 (DR994_04110) - 769794..770723 (-) 930 WP_002952720.1 peptidase U32 family protein -
  DR994_RS03980 (DR994_04115) - 770956..771252 (+) 297 WP_002945999.1 DUF3270 domain-containing protein -
  DR994_RS03985 (DR994_04120) - 771273..771713 (-) 441 WP_173940465.1 YtxH domain-containing protein -
  DR994_RS03990 (DR994_04125) - 771726..772124 (-) 399 WP_022096784.1 DUF948 domain-containing protein -
  DR994_RS03995 (DR994_04130) lgt 772247..773038 (-) 792 WP_011225734.1 prolipoprotein diacylglyceryl transferase -
  DR994_RS04000 (DR994_04135) hprK 773038..773967 (-) 930 WP_173940466.1 HPr(Ser) kinase/phosphatase -
  DR994_RS04005 (DR994_04140) - 774096..774359 (-) 264 WP_011225732.1 PspC domain-containing protein -
  DR994_RS04010 (DR994_04145) - 774425..774865 (-) 441 WP_002946099.1 SprT family protein -
  DR994_RS04015 (DR994_04150) - 774852..776984 (-) 2133 WP_173940467.1 Tex family protein -
  DR994_RS09905 - 777211..777342 (+) 132 WP_002952698.1 SPJ_0845 family protein -
  DR994_RS04020 (DR994_04155) - 777348..778250 (+) 903 WP_173940468.1 permease -
  DR994_RS04025 (DR994_04160) - 778250..779065 (+) 816 WP_173940469.1 TIGR03943 family protein -
  DR994_RS04030 (DR994_04165) csn2-St 779997..781049 (-) 1053 WP_173940470.1 CRISPR-associated protein Csn2-St -
  DR994_RS04035 (DR994_04170) cas2 781046..781369 (-) 324 WP_002946754.1 CRISPR-associated endonuclease Cas2 -
  DR994_RS04040 (DR994_04175) cas1 781371..782282 (-) 912 WP_011227029.1 type II CRISPR-associated endonuclease Cas1 -
  DR994_RS04045 (DR994_04180) cas9 782459..785827 (-) 3369 WP_173940471.1 type II CRISPR RNA-guided endonuclease Cas9 -
  DR994_RS04050 (DR994_04185) - 786084..786695 (-) 612 WP_173940472.1 DUF2140 domain-containing protein -
  DR994_RS04055 (DR994_04190) - 786865..787122 (+) 258 WP_002950317.1 hypothetical protein -
  DR994_RS04060 (DR994_04195) - 787289..787750 (-) 462 WP_232982986.1 DNA adenine methylase -
  DR994_RS04065 (DR994_04200) - 787747..787968 (-) 222 WP_011680955.1 helix-turn-helix domain-containing protein -
  DR994_RS04070 (DR994_04205) - 788136..788966 (-) 831 WP_173940473.1 GIY-YIG nuclease family protein -
  DR994_RS04075 (DR994_04210) - 789168..790964 (-) 1797 WP_173940474.1 recombinase family protein -
  DR994_RS10245 - 791018..791146 (-) 129 WP_255199103.1 hypothetical protein -
  DR994_RS04080 (DR994_04215) - 791471..791866 (-) 396 WP_065973048.1 hypothetical protein -
  DR994_RS04085 - 792052..792204 (-) 153 WP_155758745.1 hypothetical protein -
  DR994_RS04090 (DR994_04220) - 792234..792929 (-) 696 WP_065973047.1 type II CAAX endopeptidase family protein -
  DR994_RS04095 (DR994_04225) - 792933..793964 (-) 1032 WP_065973046.1 thioredoxin fold domain-containing protein -
  DR994_RS04105 (DR994_04235) - 796339..796533 (-) 195 WP_039671026.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  DR994_RS04110 (DR994_04240) - 796550..796807 (-) 258 WP_039671027.1 Blp family class II bacteriocin -
  DR994_RS04115 (DR994_04245) comA/nlmT 797105..799258 (+) 2154 WP_024404830.1 peptide cleavage/export ABC transporter Regulator
  DR994_RS04120 (DR994_04250) - 799270..800631 (+) 1362 WP_173940475.1 bacteriocin secretion accessory protein -
  DR994_RS04125 (DR994_04255) - 800730..800885 (+) 156 WP_096811960.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  DR994_RS04130 (DR994_04260) - 800933..802273 (-) 1341 WP_039671036.1 GHKL domain-containing protein -
  DR994_RS04135 (DR994_04265) comE/blpR 802284..803024 (-) 741 WP_173940476.1 response regulator transcription factor Regulator
  DR994_RS04140 (DR994_04270) - 803026..803367 (-) 342 WP_024404826.1 LytTR family DNA-binding domain-containing protein -
  DR994_RS09910 - 803566..803961 (+) 396 WP_232085807.1 hypothetical protein -
  DR994_RS04150 (DR994_04280) - 803894..805777 (-) 1884 WP_173940477.1 SAG1250 family conjugative relaxase -
  DR994_RS04155 (DR994_04285) mobC 805764..806129 (-) 366 WP_039671039.1 plasmid mobilization relaxosome protein MobC -
  DR994_RS04160 (DR994_04290) - 806132..806494 (-) 363 WP_039671040.1 SAG1252 family conjugative relaxosome accessory protein -
  DR994_RS04165 (DR994_04300) - 807000..808415 (-) 1416 WP_010730302.1 HEPN domain-containing protein -

Sequence

Protein


Download         Length: 246 a.a.        Molecular weight: 28895.09 Da        Isoelectric Point: 6.7719

>NTDB_id=302350 DR994_RS04135 WP_173940476.1 802284..803024(-) (comE/blpR) [Streptococcus thermophilus strain CS9]
MNIFVMEDDFMQQARIEKIITKLLEKHNIVPKKFEISGEPHQLLQAIEEKGVHQLFFLDIEIKEDELKGLQVAKQIREID
PYASIVFVTTHSEFMPLSFRYQVSALDYIDKELGVTEFESRIEAALLHTHNKDNSAVSDDSFYFKSKYAQVQYPFNEVYY
IETSPRPHRVILYTKTDRMEFTASLSDILKQDKRLVQCHRSFAINPRNVVKVDRNEKQIYFPNGATCFISRQKLESTLAV
IDRLHR

Nucleotide


Download         Length: 741 bp        

>NTDB_id=302350 DR994_RS04135 WP_173940476.1 802284..803024(-) (comE/blpR) [Streptococcus thermophilus strain CS9]
ATGAATATCTTTGTAATGGAAGATGATTTTATGCAACAAGCGAGAATTGAGAAGATTATTACTAAGCTGTTAGAAAAGCA
CAACATCGTTCCGAAAAAATTTGAAATTTCAGGAGAACCTCATCAGCTACTTCAAGCAATAGAAGAAAAAGGAGTACATC
AGCTCTTCTTTTTAGATATTGAGATTAAGGAAGACGAACTAAAAGGACTTCAAGTCGCTAAACAAATTAGAGAGATTGAC
CCTTATGCTAGTATTGTTTTTGTGACAACACACTCCGAGTTTATGCCCTTATCTTTCAGGTACCAGGTATCTGCCTTGGA
CTATATTGACAAAGAGCTTGGAGTTACCGAATTTGAATCGCGAATAGAAGCAGCTTTACTTCATACTCACAATAAGGACA
ATAGCGCCGTATCGGATGATTCATTCTATTTTAAGTCCAAATATGCTCAAGTACAATACCCATTCAATGAAGTGTACTAC
ATCGAGACTTCTCCCCGCCCTCATCGTGTTATCCTTTATACCAAGACAGACCGAATGGAGTTCACAGCAAGTTTGTCAGA
CATTTTGAAACAAGATAAACGACTTGTACAATGTCATCGTTCGTTTGCAATCAATCCGAGGAATGTTGTTAAAGTGGATA
GAAATGAAAAACAGATCTACTTTCCTAATGGAGCCACCTGTTTTATTTCAAGGCAAAAGCTAGAATCAACTTTAGCTGTT
ATTGATAGACTGCATAGATAA

Domains

Predicted by InterproScan.

LytTr DNA-binding domain (LytTR)

(151-235)

Response regulator receiver domain (Response_reg)

(3-122)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

53.306

98.374

0.524
  comE/comE1 Streptococcus equinus JB1

41.423

97.154

0.402
  comE/comE2 Streptococcus equinus JB1

36.885

99.187

0.366

Multiple sequence alignment