Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilK   Type   Machinery gene
Locus tag   DRA65_RS02670 Genome accession   NZ_CP030826
Coordinates   518879..519478 (+) Length   199 a.a.
NCBI ID   WP_002248501.1    Uniprot ID   -
Organism   Neisseria meningitidis strain 11-251     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 509108..566931 518879..519478 within 0


Gene organization within MGE regions


Location: 509108..566931
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DRA65_RS02620 (DRA65_03010) - 509108..510181 (-) 1074 WP_002229312.1 sulfate/molybdate ABC transporter ATP-binding protein -
  DRA65_RS02625 (DRA65_03015) cysW 510178..511038 (-) 861 WP_002220668.1 sulfate ABC transporter permease subunit CysW -
  DRA65_RS02630 (DRA65_03020) cysT 511290..512126 (-) 837 WP_002217475.1 sulfate ABC transporter permease subunit CysT -
  DRA65_RS02635 (DRA65_03025) - 512416..512748 (+) 333 WP_002226445.1 hypothetical protein -
  DRA65_RS02640 (DRA65_03030) - 513080..513589 (+) 510 WP_002213852.1 isoprenylcysteine carboxyl methyltransferase family protein -
  DRA65_RS02645 (DRA65_03040) - 514161..514748 (-) 588 WP_002248497.1 superoxide dismutase -
  DRA65_RS02650 (DRA65_03050) dnaB 514911..516317 (+) 1407 WP_002248498.1 replicative DNA helicase -
  DRA65_RS02655 (DRA65_03055) pilH 516626..517294 (+) 669 WP_002249139.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  DRA65_RS02660 (DRA65_03060) pilV 517324..517938 (+) 615 WP_196083683.1 type IV pilus modification protein PilV Machinery gene
  DRA65_RS02665 (DRA65_03065) pilJ 517935..518900 (+) 966 WP_196083679.1 PilW family protein Machinery gene
  DRA65_RS02670 (DRA65_03070) pilK 518879..519478 (+) 600 WP_002248501.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  DRA65_RS02675 (DRA65_03075) pilX 519483..519956 (+) 474 WP_196083684.1 PilX family type IV pilin Machinery gene
  DRA65_RS02680 (DRA65_03100) - 522063..522491 (-) 429 Protein_514 AzlC family ABC transporter permease -
  DRA65_RS02685 (DRA65_03105) dut 522634..523086 (+) 453 WP_002220679.1 dUTP diphosphatase -
  DRA65_RS02690 (DRA65_03110) dapC 523162..524349 (+) 1188 WP_002220680.1 succinyldiaminopimelate transaminase -
  DRA65_RS11530 - 524437..524562 (+) 126 Protein_517 IS5/IS1182 family transposase -
  DRA65_RS02695 (DRA65_03120) yaaA 524611..525390 (+) 780 WP_002220681.1 peroxide stress protein YaaA -
  DRA65_RS02710 (DRA65_03135) - 525922..527117 (+) 1196 Protein_519 tyrosine-type recombinase/integrase -
  DRA65_RS02715 (DRA65_03140) - 527272..527652 (+) 381 WP_002220683.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DRA65_RS02720 (DRA65_03150) - 528055..528567 (+) 513 WP_002220685.1 DUF4760 domain-containing protein -
  DRA65_RS02725 (DRA65_03155) - 529435..530352 (+) 918 WP_002220686.1 KilA-N domain-containing protein -
  DRA65_RS02730 (DRA65_03160) - 530410..530619 (-) 210 WP_002220687.1 hypothetical protein -
  DRA65_RS02735 (DRA65_03165) - 530616..530756 (-) 141 WP_002220688.1 hypothetical protein -
  DRA65_RS02740 (DRA65_03170) - 530756..530947 (-) 192 WP_002219435.1 type ISP restriction/modification enzyme -
  DRA65_RS02745 (DRA65_03175) - 530950..531243 (-) 294 WP_002220689.1 hypothetical protein -
  DRA65_RS02750 (DRA65_03180) - 531240..531500 (-) 261 WP_002220690.1 NGO1622 family putative holin -
  DRA65_RS02755 (DRA65_03185) - 531536..531751 (-) 216 WP_002220692.1 hypothetical protein -
  DRA65_RS02760 (DRA65_03190) - 531823..532677 (-) 855 WP_002220693.1 YfdQ family protein -
  DRA65_RS02765 (DRA65_03195) - 532702..533061 (-) 360 WP_002220694.1 hypothetical protein -
  DRA65_RS02770 (DRA65_03200) - 533129..533329 (-) 201 WP_002219431.1 hypothetical protein -
  DRA65_RS02775 (DRA65_03205) - 533560..533985 (-) 426 WP_002220695.1 hypothetical protein -
  DRA65_RS02780 (DRA65_03210) - 534088..534804 (-) 717 WP_002220696.1 helix-turn-helix transcriptional regulator -
  DRA65_RS02785 (DRA65_03220) - 535204..535551 (+) 348 WP_002220698.1 hypothetical protein -
  DRA65_RS02790 (DRA65_03225) - 535666..538512 (+) 2847 WP_002220699.1 primase-helicase family protein -
  DRA65_RS02795 (DRA65_03230) - 538529..538738 (+) 210 WP_002220700.1 hypothetical protein -
  DRA65_RS02800 (DRA65_03235) - 538741..539127 (+) 387 WP_002220701.1 DUF3310 domain-containing protein -
  DRA65_RS02805 (DRA65_03240) - 539114..539368 (+) 255 WP_002220702.1 hypothetical protein -
  DRA65_RS02810 (DRA65_03245) - 539377..540939 (+) 1563 WP_002220703.1 phage portal protein -
  DRA65_RS02815 (DRA65_03250) - 540920..542812 (+) 1893 WP_002220704.1 phage major capsid protein -
  DRA65_RS02820 (DRA65_03255) - 542870..543097 (+) 228 WP_002220705.1 hypothetical protein -
  DRA65_RS02825 (DRA65_03260) - 543090..543392 (+) 303 WP_002244523.1 hypothetical protein -
  DRA65_RS02830 (DRA65_03265) - 543373..543792 (+) 420 WP_002244524.1 hypothetical protein -
  DRA65_RS02835 (DRA65_03270) - 543824..544465 (+) 642 WP_002220708.1 phage tail protein -
  DRA65_RS02840 (DRA65_03275) - 544529..544840 (+) 312 WP_002220709.1 phage tail assembly chaperone -
  DRA65_RS02845 (DRA65_03280) - 544888..545160 (+) 273 WP_002220710.1 DUF1799 domain-containing protein -
  DRA65_RS02850 (DRA65_03285) - 545153..548371 (+) 3219 WP_002224445.1 phage tail length tape measure family protein -
  DRA65_RS02855 (DRA65_03290) - 548393..548662 (+) 270 WP_002217457.1 phage tail protein -
  DRA65_RS02860 (DRA65_03295) - 548722..549444 (+) 723 WP_002217456.1 phage minor tail protein L -
  DRA65_RS02865 (DRA65_03300) - 549441..550196 (+) 756 WP_002244525.1 C40 family peptidase -
  DRA65_RS02870 (DRA65_03305) - 550193..550915 (+) 723 WP_002220716.1 tail assembly protein -
  DRA65_RS02875 (DRA65_03310) - 551051..555316 (+) 4266 WP_002220717.1 phage tail protein -
  DRA65_RS02880 (DRA65_03315) - 555387..555833 (+) 447 WP_002220718.1 hypothetical protein -
  DRA65_RS11450 (DRA65_03320) - 555850..556056 (+) 207 WP_002217448.1 hypothetical protein -
  DRA65_RS02885 (DRA65_03325) - 556124..556495 (+) 372 WP_002220720.1 hypothetical protein -
  DRA65_RS02890 (DRA65_03330) - 556559..556984 (+) 426 WP_002220721.1 hypothetical protein -
  DRA65_RS02895 (DRA65_03335) - 556981..557256 (+) 276 WP_002217443.1 hypothetical protein -
  DRA65_RS02900 (DRA65_03340) - 557395..557868 (+) 474 WP_002220733.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  DRA65_RS02905 (DRA65_03345) - 557880..558389 (+) 510 WP_002220734.1 hypothetical protein -
  DRA65_RS02910 (DRA65_03350) - 558442..558789 (-) 348 WP_002217440.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DRA65_RS02915 (DRA65_03355) - 558791..559027 (-) 237 WP_002217439.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  DRA65_RS02920 (DRA65_03360) - 559386..559982 (-) 597 WP_229016375.1 DUF4760 domain-containing protein -
  DRA65_RS02930 (DRA65_03365) - 560315..560683 (-) 369 WP_002220735.1 type II toxin-antitoxin system death-on-curing family toxin -
  DRA65_RS11330 (DRA65_03370) - 560680..560811 (-) 132 WP_002217434.1 hypothetical protein -
  DRA65_RS02935 (DRA65_03380) - 561227..562195 (-) 969 Protein_565 IS5 family transposase -
  DRA65_RS02940 (DRA65_03385) - 562333..563340 (-) 1008 Protein_566 IS5 family transposase -
  DRA65_RS02945 (DRA65_03395) - 563404..563538 (-) 135 Protein_567 IS110 family transposase -
  DRA65_RS02950 (DRA65_03410) - 564706..566931 (-) 2226 WP_002220751.1 NADP-dependent isocitrate dehydrogenase -

Sequence


Protein


Download         Length: 199 a.a.        Molecular weight: 21935.90 Da        Isoelectric Point: 6.9099

>NTDB_id=301763 DRA65_RS02670 WP_002248501.1 518879..519478(+) (pilK) [Neisseria meningitidis strain 11-251]
MRKQNTLTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISTNESDRKLALSLAEAALREGELQVLDLEYDT
DSKVTFSENCGKGLCTAVNVRTNTNNGNEEAFDNIVVQGKPIVEAVKRFCPANSTDLCIDKKGMEYKKGTRSVSKPPHYI
IEYLGVKNGENVYRVTAKAWGKNANTVVVLQSYVSNNDE

Nucleotide


Download         Length: 600 bp        

>NTDB_id=301763 DRA65_RS02670 WP_002248501.1 518879..519478(+) (pilK) [Neisseria meningitidis strain 11-251]
ATGCGCAAACAGAACACTTTGACGGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTACTGATGGT
GATGATCGTCGTGGCATTTTTGGTTGTAACTGCCGCGCAGTCTTACAATACCGAGCAGAGGATCAGTACCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTGGCCGAGGCGGCTTTGCGGGAAGGCGAACTTCAGGTTTTGGATTTGGAATATGATACG
GACAGTAAGGTTACATTTAGTGAAAACTGTGGAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATACAAATAATGG
TAATGAAGAGGCTTTTGACAATATCGTGGTGCAAGGCAAGCCCATCGTTGAGGCGGTGAAGCGTTTTTGCCCTGCAAATT
CTACCGACCTGTGCATTGACAAGAAAGGGATGGAATATAAGAAAGGCACGAGAAGCGTCAGCAAACCACCACACTATATT
ATCGAATATTTGGGCGTGAAGAACGGAGAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAATACCGT
GGTCGTCCTTCAATCTTATGTAAGCAATAATGATGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

85.222

100

0.869


Multiple sequence alignment