Detailed information
Overview
| Name | pilV | Type | Machinery gene |
| Locus tag | DRA65_RS02660 | Genome accession | NZ_CP030826 |
| Coordinates | 517324..517938 (+) | Length | 204 a.a. |
| NCBI ID | WP_196083683.1 | Uniprot ID | - |
| Organism | Neisseria meningitidis strain 11-251 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 509108..566931 | 517324..517938 | within | 0 |
Gene organization within MGE regions
Location: 509108..566931
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DRA65_RS02620 (DRA65_03010) | - | 509108..510181 (-) | 1074 | WP_002229312.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| DRA65_RS02625 (DRA65_03015) | cysW | 510178..511038 (-) | 861 | WP_002220668.1 | sulfate ABC transporter permease subunit CysW | - |
| DRA65_RS02630 (DRA65_03020) | cysT | 511290..512126 (-) | 837 | WP_002217475.1 | sulfate ABC transporter permease subunit CysT | - |
| DRA65_RS02635 (DRA65_03025) | - | 512416..512748 (+) | 333 | WP_002226445.1 | hypothetical protein | - |
| DRA65_RS02640 (DRA65_03030) | - | 513080..513589 (+) | 510 | WP_002213852.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| DRA65_RS02645 (DRA65_03040) | - | 514161..514748 (-) | 588 | WP_002248497.1 | superoxide dismutase | - |
| DRA65_RS02650 (DRA65_03050) | dnaB | 514911..516317 (+) | 1407 | WP_002248498.1 | replicative DNA helicase | - |
| DRA65_RS02655 (DRA65_03055) | pilH | 516626..517294 (+) | 669 | WP_002249139.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| DRA65_RS02660 (DRA65_03060) | pilV | 517324..517938 (+) | 615 | WP_196083683.1 | type IV pilus modification protein PilV | Machinery gene |
| DRA65_RS02665 (DRA65_03065) | pilJ | 517935..518900 (+) | 966 | WP_196083679.1 | PilW family protein | Machinery gene |
| DRA65_RS02670 (DRA65_03070) | pilK | 518879..519478 (+) | 600 | WP_002248501.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| DRA65_RS02675 (DRA65_03075) | pilX | 519483..519956 (+) | 474 | WP_196083684.1 | PilX family type IV pilin | Machinery gene |
| DRA65_RS02680 (DRA65_03100) | - | 522063..522491 (-) | 429 | Protein_514 | AzlC family ABC transporter permease | - |
| DRA65_RS02685 (DRA65_03105) | dut | 522634..523086 (+) | 453 | WP_002220679.1 | dUTP diphosphatase | - |
| DRA65_RS02690 (DRA65_03110) | dapC | 523162..524349 (+) | 1188 | WP_002220680.1 | succinyldiaminopimelate transaminase | - |
| DRA65_RS11530 | - | 524437..524562 (+) | 126 | Protein_517 | IS5/IS1182 family transposase | - |
| DRA65_RS02695 (DRA65_03120) | yaaA | 524611..525390 (+) | 780 | WP_002220681.1 | peroxide stress protein YaaA | - |
| DRA65_RS02710 (DRA65_03135) | - | 525922..527117 (+) | 1196 | Protein_519 | tyrosine-type recombinase/integrase | - |
| DRA65_RS02715 (DRA65_03140) | - | 527272..527652 (+) | 381 | WP_002220683.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DRA65_RS02720 (DRA65_03150) | - | 528055..528567 (+) | 513 | WP_002220685.1 | DUF4760 domain-containing protein | - |
| DRA65_RS02725 (DRA65_03155) | - | 529435..530352 (+) | 918 | WP_002220686.1 | KilA-N domain-containing protein | - |
| DRA65_RS02730 (DRA65_03160) | - | 530410..530619 (-) | 210 | WP_002220687.1 | hypothetical protein | - |
| DRA65_RS02735 (DRA65_03165) | - | 530616..530756 (-) | 141 | WP_002220688.1 | hypothetical protein | - |
| DRA65_RS02740 (DRA65_03170) | - | 530756..530947 (-) | 192 | WP_002219435.1 | type ISP restriction/modification enzyme | - |
| DRA65_RS02745 (DRA65_03175) | - | 530950..531243 (-) | 294 | WP_002220689.1 | hypothetical protein | - |
| DRA65_RS02750 (DRA65_03180) | - | 531240..531500 (-) | 261 | WP_002220690.1 | NGO1622 family putative holin | - |
| DRA65_RS02755 (DRA65_03185) | - | 531536..531751 (-) | 216 | WP_002220692.1 | hypothetical protein | - |
| DRA65_RS02760 (DRA65_03190) | - | 531823..532677 (-) | 855 | WP_002220693.1 | YfdQ family protein | - |
| DRA65_RS02765 (DRA65_03195) | - | 532702..533061 (-) | 360 | WP_002220694.1 | hypothetical protein | - |
| DRA65_RS02770 (DRA65_03200) | - | 533129..533329 (-) | 201 | WP_002219431.1 | hypothetical protein | - |
| DRA65_RS02775 (DRA65_03205) | - | 533560..533985 (-) | 426 | WP_002220695.1 | hypothetical protein | - |
| DRA65_RS02780 (DRA65_03210) | - | 534088..534804 (-) | 717 | WP_002220696.1 | helix-turn-helix transcriptional regulator | - |
| DRA65_RS02785 (DRA65_03220) | - | 535204..535551 (+) | 348 | WP_002220698.1 | hypothetical protein | - |
| DRA65_RS02790 (DRA65_03225) | - | 535666..538512 (+) | 2847 | WP_002220699.1 | primase-helicase family protein | - |
| DRA65_RS02795 (DRA65_03230) | - | 538529..538738 (+) | 210 | WP_002220700.1 | hypothetical protein | - |
| DRA65_RS02800 (DRA65_03235) | - | 538741..539127 (+) | 387 | WP_002220701.1 | DUF3310 domain-containing protein | - |
| DRA65_RS02805 (DRA65_03240) | - | 539114..539368 (+) | 255 | WP_002220702.1 | hypothetical protein | - |
| DRA65_RS02810 (DRA65_03245) | - | 539377..540939 (+) | 1563 | WP_002220703.1 | phage portal protein | - |
| DRA65_RS02815 (DRA65_03250) | - | 540920..542812 (+) | 1893 | WP_002220704.1 | phage major capsid protein | - |
| DRA65_RS02820 (DRA65_03255) | - | 542870..543097 (+) | 228 | WP_002220705.1 | hypothetical protein | - |
| DRA65_RS02825 (DRA65_03260) | - | 543090..543392 (+) | 303 | WP_002244523.1 | hypothetical protein | - |
| DRA65_RS02830 (DRA65_03265) | - | 543373..543792 (+) | 420 | WP_002244524.1 | hypothetical protein | - |
| DRA65_RS02835 (DRA65_03270) | - | 543824..544465 (+) | 642 | WP_002220708.1 | phage tail protein | - |
| DRA65_RS02840 (DRA65_03275) | - | 544529..544840 (+) | 312 | WP_002220709.1 | phage tail assembly chaperone | - |
| DRA65_RS02845 (DRA65_03280) | - | 544888..545160 (+) | 273 | WP_002220710.1 | DUF1799 domain-containing protein | - |
| DRA65_RS02850 (DRA65_03285) | - | 545153..548371 (+) | 3219 | WP_002224445.1 | phage tail length tape measure family protein | - |
| DRA65_RS02855 (DRA65_03290) | - | 548393..548662 (+) | 270 | WP_002217457.1 | phage tail protein | - |
| DRA65_RS02860 (DRA65_03295) | - | 548722..549444 (+) | 723 | WP_002217456.1 | phage minor tail protein L | - |
| DRA65_RS02865 (DRA65_03300) | - | 549441..550196 (+) | 756 | WP_002244525.1 | C40 family peptidase | - |
| DRA65_RS02870 (DRA65_03305) | - | 550193..550915 (+) | 723 | WP_002220716.1 | tail assembly protein | - |
| DRA65_RS02875 (DRA65_03310) | - | 551051..555316 (+) | 4266 | WP_002220717.1 | phage tail protein | - |
| DRA65_RS02880 (DRA65_03315) | - | 555387..555833 (+) | 447 | WP_002220718.1 | hypothetical protein | - |
| DRA65_RS11450 (DRA65_03320) | - | 555850..556056 (+) | 207 | WP_002217448.1 | hypothetical protein | - |
| DRA65_RS02885 (DRA65_03325) | - | 556124..556495 (+) | 372 | WP_002220720.1 | hypothetical protein | - |
| DRA65_RS02890 (DRA65_03330) | - | 556559..556984 (+) | 426 | WP_002220721.1 | hypothetical protein | - |
| DRA65_RS02895 (DRA65_03335) | - | 556981..557256 (+) | 276 | WP_002217443.1 | hypothetical protein | - |
| DRA65_RS02900 (DRA65_03340) | - | 557395..557868 (+) | 474 | WP_002220733.1 | D-Ala-D-Ala carboxypeptidase family metallohydrolase | - |
| DRA65_RS02905 (DRA65_03345) | - | 557880..558389 (+) | 510 | WP_002220734.1 | hypothetical protein | - |
| DRA65_RS02910 (DRA65_03350) | - | 558442..558789 (-) | 348 | WP_002217440.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DRA65_RS02915 (DRA65_03355) | - | 558791..559027 (-) | 237 | WP_002217439.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| DRA65_RS02920 (DRA65_03360) | - | 559386..559982 (-) | 597 | WP_229016375.1 | DUF4760 domain-containing protein | - |
| DRA65_RS02930 (DRA65_03365) | - | 560315..560683 (-) | 369 | WP_002220735.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| DRA65_RS11330 (DRA65_03370) | - | 560680..560811 (-) | 132 | WP_002217434.1 | hypothetical protein | - |
| DRA65_RS02935 (DRA65_03380) | - | 561227..562195 (-) | 969 | Protein_565 | IS5 family transposase | - |
| DRA65_RS02940 (DRA65_03385) | - | 562333..563340 (-) | 1008 | Protein_566 | IS5 family transposase | - |
| DRA65_RS02945 (DRA65_03395) | - | 563404..563538 (-) | 135 | Protein_567 | IS110 family transposase | - |
| DRA65_RS02950 (DRA65_03410) | - | 564706..566931 (-) | 2226 | WP_002220751.1 | NADP-dependent isocitrate dehydrogenase | - |
Sequence
Protein
Download Length: 204 a.a. Molecular weight: 22215.23 Da Isoelectric Point: 5.6951
>NTDB_id=301761 DRA65_RS02660 WP_196083683.1 517324..517938(+) (pilV) [Neisseria meningitidis strain 11-251]
MKNNDCFRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYMGNHHTLSVVDGDFQVGVIKTKTQLAEVQLKRFSYELKNALPDAAAIHYAVCKDSSGAAPTLSDSGAFSRNCDDKA
NGDTLIKVLWVNDSAGDSDIARTNLEANGNNIVYTYQARVGGRE
MKNNDCFRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYMGNHHTLSVVDGDFQVGVIKTKTQLAEVQLKRFSYELKNALPDAAAIHYAVCKDSSGAAPTLSDSGAFSRNCDDKA
NGDTLIKVLWVNDSAGDSDIARTNLEANGNNIVYTYQARVGGRE
Nucleotide
Download Length: 615 bp
>NTDB_id=301761 DRA65_RS02660 WP_196083683.1 517324..517938(+) (pilV) [Neisseria meningitidis strain 11-251]
ATGAAGAATAATGATTGCTTCCGCCTGAAAAACCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCACTATTGTCTGTTCAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCAGAGACGCAAACCA
TCGTCAGTCAAATCACGCAAAACCTGATGGAGGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACATGGGAAACCATCATACACTATCAGTTGTGGATGGCGATTTTCAGGTTGGTGTCATAAAAACTAAGAC
GCAGTTGGCAGAGGTACAATTGAAGAGATTTAGTTATGAGCTGAAAAATGCCTTGCCGGATGCGGCAGCCATCCATTACG
CCGTCTGCAAGGATTCGTCGGGTGCTGCGCCGACATTGTCCGACAGCGGTGCTTTTTCTCGAAATTGCGATGATAAGGCA
AACGGGGATACTTTAATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTGCCCGTACGAATCTTGAGGC
GAACGGCAACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGGGAATGA
ATGAAGAATAATGATTGCTTCCGCCTGAAAAACCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCACTATTGTCTGTTCAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCAGAGACGCAAACCA
TCGTCAGTCAAATCACGCAAAACCTGATGGAGGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACATGGGAAACCATCATACACTATCAGTTGTGGATGGCGATTTTCAGGTTGGTGTCATAAAAACTAAGAC
GCAGTTGGCAGAGGTACAATTGAAGAGATTTAGTTATGAGCTGAAAAATGCCTTGCCGGATGCGGCAGCCATCCATTACG
CCGTCTGCAAGGATTCGTCGGGTGCTGCGCCGACATTGTCCGACAGCGGTGCTTTTTCTCGAAATTGCGATGATAAGGCA
AACGGGGATACTTTAATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTGCCCGTACGAATCTTGAGGC
GAACGGCAACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGGGAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilV | Neisseria meningitidis 8013 |
89.855 |
100 |
0.912 |
| pilI | Neisseria gonorrhoeae MS11 |
82.353 |
100 |
0.824 |
| pilV | Neisseria gonorrhoeae MS11 |
82.353 |
100 |
0.824 |