Detailed information NTG0301733

Bioinformatically predicted

Overview

• Name: comE
• Type: Machinery gene
• Locus tag: DRA66_RS07895
• Genome accession: NZ_CP030825
• Coordinates: 1575128..1575592 (-)
• Length: 154 a.a.
• NCBI ID: WP_025463168.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain 12-208
• Function: DNA binding (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1568698..1585643	1575128..1575592	within	0

Gene organization within MGE regions

Location: 1568698..1585643

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DRA66_RS07850 (DRA66_09270)	-	1570142..1570387 (-)	246	WP_002226028.1	hypothetical protein	-
DRA66_RS07855 (DRA66_09280)	-	1570499..1570927 (+)	429	WP_002226027.1	CopD family protein	-
DRA66_RS07860 (DRA66_09285)	-	1570939..1571415 (+)	477	WP_002226026.1	CYTH domain-containing protein	-
DRA66_RS07865 (DRA66_09290)	-	1571765..1572253 (-)	489	WP_002235430.1	dihydrofolate reductase	-
DRA66_RS07870 (DRA66_09295)	aroG	1572321..1573376 (-)	1056	WP_002235429.1	3-deoxy-7-phosphoheptulonate synthase AroG	-
DRA66_RS07875	-	1573538..1573765 (-)	228	WP_153310284.1	hypothetical protein	-
DRA66_RS07885 (DRA66_09305)	-	1574043..1574300 (+)	258	WP_002231679.1	membrane protein	-
DRA66_RS07890 (DRA66_09310)	-	1574349..1574453 (-)	105	Protein_1520	IS1595 family transposase	-
DRA66_RS11135 (DRA66_09315)	-	1574557..1574763 (-)	207	WP_002220254.1	hypothetical protein	-
DRA66_RS07895 (DRA66_09325)	comE	1575128..1575592 (-)	465	WP_025463168.1	ComEA family DNA-binding protein	Machinery gene
DRA66_RS07925 (DRA66_09365)	-	1581391..1582197 (-)	807	WP_002221447.1	inner membrane protein YpjD	-
DRA66_RS07930 (DRA66_09370)	ffh	1582417..1583787 (+)	1371	WP_002221448.1	signal recognition particle protein	-
DRA66_RS07935 (DRA66_09375)	dsbA2	1584118..1584813 (-)	696	WP_002215704.1	thiol:disulfide interchange protein DsbA/DsbL	Machinery gene
DRA66_RS07940 (DRA66_09380)	-	1584984..1585643 (-)	660	WP_002218694.1	NYN domain-containing protein	-

Sequence

Protein

• Length: 154 a.a.
• Molecular weight: 16561.83 Da
• Isoelectric Point: 10.9695

>NTDB_id=301733 DRA66_RS07895 WP_025463168.1 1575128..1575592(-) (comE) [Neisseria meningitidis strain 12-208]
MLYPEKMSGMAGRHPYGVRSGLRRNGLKLWDIHFRMTRFIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINA
ASQQELEALPGIGPAKAKAIAEYRAQNGAFKSVDDLTKVKGIGPAVLAKLKDQASVGAPAPKAPAKPVLPAAKK

Nucleotide

• Length: 465 bp

>NTDB_id=301733 DRA66_RS07895 WP_025463168.1 1575128..1575592(-) (comE) [Neisseria meningitidis strain 12-208]
TTGCTTTACCCGGAAAAAATGTCGGGGATGGCGGGACGGCATCCGTACGGCGTCCGGTCGGGTTTGCGGAGGAACGGCTT
GAAACTTTGGGATATTCATTTTAGAATGACCCGTTTTATCGTCGCAAGATGCGGTTTATTGTTTGCAACCCTTAAAGGAA
AAACCATGAAGAAAATGTTCGTGCTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAAACATCAATGCG
GCTTCGCAGCAGGAGTTGGAGGCGCTGCCGGGCATAGGCCCTGCGAAGGCGAAGGCCATTGCGGAATACCGTGCGCAAAA
CGGTGCGTTCAAGTCTGTGGACGATTTGACCAAGGTAAAGGGCATCGGCCCTGCGGTGCTGGCGAAGCTGAAGGATCAGG
CTTCTGTCGGCGCGCCCGCACCAAAAGCCCCAGCCAAACCGGTGCTGCCCGCAGCTAAAAAATAG

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (75-133)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Neisseria gonorrhoeae MS11	93.443	79.221	0.74
comE	Neisseria gonorrhoeae MS11	93.443	79.221	0.74
comE	Neisseria gonorrhoeae MS11	93.443	79.221	0.74
comE	Neisseria gonorrhoeae MS11	93.443	79.221	0.74