Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT65_RS00805 Genome accession   NZ_CP035434
Coordinates   119528..119812 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain emm75.1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 114528..124812
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT65_RS00780 (ETT65_00780) - 116474..116839 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT65_RS00785 (ETT65_00785) comGA 116932..117870 (+) 939 WP_023079010.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT65_RS00790 (ETT65_00790) comGB 117806..118840 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT65_RS00795 (ETT65_00795) comGC 118842..119168 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT65_RS00800 (ETT65_00800) comGD 119143..119571 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT65_RS00805 (ETT65_00805) comGE 119528..119812 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT65_RS00810 (ETT65_00810) comGF 119805..120239 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT65_RS00815 (ETT65_00815) comGG 120223..120549 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT65_RS00820 (ETT65_00820) comGH 120647..121600 (+) 954 WP_115230344.1 class I SAM-dependent methyltransferase Machinery gene
  ETT65_RS00825 (ETT65_00825) - 121659..122855 (+) 1197 WP_136097977.1 acetate kinase -
  ETT65_RS00830 (ETT65_00830) - 123041..123349 (+) 309 Protein_113 hypothetical protein -
  ETT65_RS00835 (ETT65_00835) proC 123432..124202 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=301523 ETT65_RS00805 WP_002987779.1 119528..119812(+) (comGE) [Streptococcus pyogenes strain emm75.1]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=301523 ETT65_RS00805 WP_002987779.1 119528..119812(+) (comGE) [Streptococcus pyogenes strain emm75.1]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTAAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGATGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment