Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ETA15_RS16745 Genome accession   NZ_CP035403
Coordinates   3113074..3113214 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103581     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3108074..3118214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA15_RS16720 (ETA15_16720) yuxO 3108351..3108731 (-) 381 WP_041052848.1 hotdog fold thioesterase -
  ETA15_RS16725 (ETA15_16725) comA 3108750..3109394 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETA15_RS16730 (ETA15_16730) comP 3109475..3111787 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  ETA15_RS16735 (ETA15_16735) comX 3111803..3112024 (-) 222 WP_014480704.1 competence pheromone ComX -
  ETA15_RS16740 (ETA15_16740) comQ 3112026..3112889 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  ETA15_RS16745 (ETA15_16745) degQ 3113074..3113214 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETA15_RS22245 - 3113436..3113498 (+) 63 Protein_3225 hypothetical protein -
  ETA15_RS16750 (ETA15_16750) - 3113676..3114044 (+) 369 WP_017695529.1 hypothetical protein -
  ETA15_RS16755 (ETA15_16755) pdeH 3114020..3115249 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ETA15_RS16760 (ETA15_16760) pncB 3115386..3116858 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ETA15_RS16765 (ETA15_16765) pncA 3116874..3117425 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  ETA15_RS16770 (ETA15_16770) yueI 3117522..3117920 (-) 399 WP_017695530.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=299836 ETA15_RS16745 WP_003220708.1 3113074..3113214(-) (degQ) [Bacillus subtilis strain SRCM103581]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=299836 ETA15_RS16745 WP_003220708.1 3113074..3113214(-) (degQ) [Bacillus subtilis strain SRCM103581]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment