Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BVDSYZ_RS16590 Genome accession   NZ_CP030150
Coordinates   3299012..3299152 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain DSYZ     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3294012..3304152
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVDSYZ_RS16565 (BVDSYZ_16565) - 3294309..3294692 (-) 384 WP_040238946.1 hotdog fold thioesterase -
  BVDSYZ_RS16570 (BVDSYZ_16570) comA 3294714..3295358 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BVDSYZ_RS16575 (BVDSYZ_16575) comP 3295439..3297742 (-) 2304 WP_040238945.1 histidine kinase Regulator
  BVDSYZ_RS16580 (BVDSYZ_16580) comX 3297762..3297941 (-) 180 WP_306383677.1 competence pheromone ComX -
  BVDSYZ_RS16585 (BVDSYZ_16585) comQ 3297895..3298881 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  BVDSYZ_RS16590 (BVDSYZ_16590) degQ 3299012..3299152 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BVDSYZ_RS16600 (BVDSYZ_16600) - 3299615..3299956 (+) 342 WP_015418107.1 hypothetical protein -
  BVDSYZ_RS16605 (BVDSYZ_16605) - 3299963..3301186 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BVDSYZ_RS16610 (BVDSYZ_16610) - 3301316..3302782 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  BVDSYZ_RS16615 (BVDSYZ_16615) - 3302800..3303351 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  BVDSYZ_RS16620 (BVDSYZ_16620) - 3303448..3303846 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=299737 BVDSYZ_RS16590 WP_003152043.1 3299012..3299152(-) (degQ) [Bacillus velezensis strain DSYZ]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=299737 BVDSYZ_RS16590 WP_003152043.1 3299012..3299152(-) (degQ) [Bacillus velezensis strain DSYZ]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment