Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DOU31_RS04585 | Genome accession | NZ_CP030042 |
| Coordinates | 926518..927045 (+) | Length | 175 a.a. |
| NCBI ID | WP_010776361.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain C25 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 916790..977635 | 926518..927045 | within | 0 |
Gene organization within MGE regions
Location: 916790..977635
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DOU31_RS04500 (DOU31_04495) | - | 916790..917926 (-) | 1137 | WP_002405155.1 | tyrosine-type recombinase/integrase | - |
| DOU31_RS04505 (DOU31_04500) | - | 917993..918565 (-) | 573 | WP_010776364.1 | hypothetical protein | - |
| DOU31_RS04510 (DOU31_04505) | - | 918626..918826 (-) | 201 | WP_002389192.1 | hypothetical protein | - |
| DOU31_RS04515 (DOU31_04510) | - | 918850..919551 (-) | 702 | WP_002404917.1 | DUF5067 domain-containing protein | - |
| DOU31_RS04520 (DOU31_04515) | - | 919640..920155 (-) | 516 | WP_002404918.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DOU31_RS04525 (DOU31_04520) | - | 920130..920702 (-) | 573 | WP_002404919.1 | helix-turn-helix domain-containing protein | - |
| DOU31_RS04530 (DOU31_04525) | - | 920861..921094 (+) | 234 | WP_002389146.1 | DUF739 family protein | - |
| DOU31_RS04535 (DOU31_04530) | - | 921176..921895 (+) | 720 | WP_002404920.1 | phage antirepressor KilAC domain-containing protein | - |
| DOU31_RS04540 (DOU31_04535) | - | 921911..922159 (+) | 249 | WP_002389279.1 | hypothetical protein | - |
| DOU31_RS15160 (DOU31_04540) | - | 922181..922354 (+) | 174 | WP_002404922.1 | hypothetical protein | - |
| DOU31_RS15165 | - | 922462..922617 (+) | 156 | WP_002395694.1 | hypothetical protein | - |
| DOU31_RS04555 (DOU31_04550) | - | 922674..922910 (+) | 237 | WP_002389004.1 | hypothetical protein | - |
| DOU31_RS04560 (DOU31_04555) | - | 922911..923588 (+) | 678 | WP_002404924.1 | ERF family protein | - |
| DOU31_RS04565 (DOU31_04560) | - | 923573..924511 (+) | 939 | WP_002404925.1 | DUF1351 domain-containing protein | - |
| DOU31_RS04570 (DOU31_04565) | - | 924508..925188 (+) | 681 | WP_002404926.1 | putative HNHc nuclease | - |
| DOU31_RS04575 (DOU31_04570) | - | 925207..926220 (+) | 1014 | WP_048670087.1 | hypothetical protein | - |
| DOU31_RS04580 (DOU31_04575) | - | 926220..926528 (+) | 309 | WP_002381633.1 | MazG-like family protein | - |
| DOU31_RS04585 (DOU31_04580) | ssb | 926518..927045 (+) | 528 | WP_010776361.1 | single-stranded DNA-binding protein | Machinery gene |
| DOU31_RS04590 (DOU31_04585) | - | 927057..927386 (+) | 330 | WP_078122599.1 | hypothetical protein | - |
| DOU31_RS04595 (DOU31_04590) | - | 927406..927612 (+) | 207 | WP_025190349.1 | hypothetical protein | - |
| DOU31_RS04600 (DOU31_04595) | - | 927666..928148 (+) | 483 | WP_078122598.1 | class I SAM-dependent methyltransferase | - |
| DOU31_RS04615 (DOU31_04610) | - | 928558..928905 (+) | 348 | WP_164978499.1 | hypothetical protein | - |
| DOU31_RS04620 (DOU31_04615) | - | 928905..929129 (+) | 225 | WP_078122597.1 | hypothetical protein | - |
| DOU31_RS04625 (DOU31_04620) | - | 929144..929380 (+) | 237 | WP_078122596.1 | hypothetical protein | - |
| DOU31_RS04630 (DOU31_04625) | - | 929386..929709 (+) | 324 | WP_089201922.1 | DNA-directed RNA polymerase subunit delta | - |
| DOU31_RS04635 (DOU31_04630) | - | 929706..929957 (+) | 252 | WP_078122594.1 | hypothetical protein | - |
| DOU31_RS04640 (DOU31_04635) | - | 929969..930208 (+) | 240 | WP_074653948.1 | hypothetical protein | - |
| DOU31_RS04645 (DOU31_04640) | - | 930211..930702 (+) | 492 | WP_078122593.1 | DUF1642 domain-containing protein | - |
| DOU31_RS15170 | - | 930703..930864 (+) | 162 | WP_164978496.1 | hypothetical protein | - |
| DOU31_RS15175 (DOU31_04645) | - | 930864..931034 (+) | 171 | WP_010776353.1 | hypothetical protein | - |
| DOU31_RS04660 (DOU31_04655) | - | 931457..931873 (+) | 417 | WP_002357362.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DOU31_RS15280 (DOU31_04665) | - | 933454..933678 (+) | 225 | WP_002404955.1 | hypothetical protein | - |
| DOU31_RS04675 (DOU31_04670) | terS | 933731..934525 (+) | 795 | WP_002404957.1 | phage terminase small subunit | - |
| DOU31_RS04680 (DOU31_04675) | - | 934497..935816 (+) | 1320 | WP_138807301.1 | PBSX family phage terminase large subunit | - |
| DOU31_RS04685 (DOU31_04680) | - | 935834..937372 (+) | 1539 | WP_002404959.1 | phage portal protein | - |
| DOU31_RS04690 (DOU31_04685) | - | 937377..938315 (+) | 939 | WP_002404960.1 | minor capsid protein | - |
| DOU31_RS04695 (DOU31_04690) | - | 938316..938585 (+) | 270 | WP_002404961.1 | hypothetical protein | - |
| DOU31_RS04700 (DOU31_04695) | - | 938680..938943 (+) | 264 | WP_025188184.1 | DUF6275 family protein | - |
| DOU31_RS04705 (DOU31_04700) | - | 939066..939665 (+) | 600 | WP_002404963.1 | DUF4355 domain-containing protein | - |
| DOU31_RS04710 (DOU31_04705) | - | 939678..940610 (+) | 933 | WP_002404964.1 | phage major capsid protein | - |
| DOU31_RS04715 (DOU31_04710) | - | 940684..941016 (+) | 333 | WP_002404965.1 | phage head-tail connector protein | - |
| DOU31_RS04720 (DOU31_04715) | - | 941013..941348 (+) | 336 | WP_002404966.1 | hypothetical protein | - |
| DOU31_RS04725 (DOU31_04720) | - | 941323..941703 (+) | 381 | WP_002402384.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DOU31_RS04730 (DOU31_04725) | - | 941700..942089 (+) | 390 | WP_002404967.1 | hypothetical protein | - |
| DOU31_RS04735 (DOU31_04730) | - | 942105..942635 (+) | 531 | WP_002404968.1 | phage major tail protein, TP901-1 family | - |
| DOU31_RS04740 (DOU31_04735) | - | 942713..943171 (+) | 459 | WP_002404969.1 | hypothetical protein | - |
| DOU31_RS04745 (DOU31_04740) | - | 943227..943577 (+) | 351 | WP_002404970.1 | tail assembly chaperone | - |
| DOU31_RS04750 (DOU31_04745) | - | 943670..943927 (+) | 258 | WP_002404971.1 | hypothetical protein | - |
| DOU31_RS04755 (DOU31_04750) | - | 943943..947350 (+) | 3408 | WP_010776350.1 | tape measure protein | - |
| DOU31_RS04760 (DOU31_04755) | - | 947351..948280 (+) | 930 | WP_002373078.1 | distal tail protein Dit | - |
| DOU31_RS04765 (DOU31_04760) | - | 948297..950315 (+) | 2019 | WP_002404973.1 | phage tail protein | - |
| DOU31_RS15180 | - | 950316..950489 (+) | 174 | WP_002404974.1 | hypothetical protein | - |
| DOU31_RS04770 (DOU31_04765) | - | 950501..952885 (+) | 2385 | WP_236922054.1 | glycerophosphodiester phosphodiesterase family protein | - |
| DOU31_RS04775 (DOU31_04770) | - | 952977..953204 (+) | 228 | WP_002381665.1 | hypothetical protein | - |
| DOU31_RS04780 (DOU31_04775) | - | 953201..953404 (+) | 204 | WP_002369080.1 | phage holin | - |
| DOU31_RS04785 (DOU31_04780) | - | 953409..954668 (+) | 1260 | WP_002404976.1 | LysM peptidoglycan-binding domain-containing protein | - |
| DOU31_RS04790 (DOU31_04785) | - | 954770..955366 (-) | 597 | WP_002404977.1 | hypothetical protein | - |
| DOU31_RS04795 (DOU31_04790) | - | 955378..955767 (-) | 390 | WP_002404978.1 | DUF6941 family protein | - |
| DOU31_RS04805 (DOU31_04800) | - | 956069..957031 (+) | 963 | WP_002404979.1 | Abi family protein | - |
| DOU31_RS04810 (DOU31_04805) | - | 957127..957375 (-) | 249 | WP_002404980.1 | hypothetical protein | - |
| DOU31_RS04820 (DOU31_04815) | - | 957709..958089 (-) | 381 | WP_002356881.1 | PH domain-containing protein | - |
| DOU31_RS04825 (DOU31_04820) | - | 958347..959585 (-) | 1239 | WP_138807084.1 | aminopeptidase | - |
| DOU31_RS04830 (DOU31_04825) | - | 959836..960408 (+) | 573 | WP_002356883.1 | TetR/AcrR family transcriptional regulator | - |
| DOU31_RS04835 (DOU31_04830) | - | 960566..961039 (+) | 474 | WP_002356884.1 | TspO/MBR family protein | - |
| DOU31_RS04840 (DOU31_04835) | - | 961113..961556 (-) | 444 | WP_002356885.1 | flavodoxin | - |
| DOU31_RS04845 (DOU31_04840) | map | 961731..962495 (+) | 765 | WP_002356886.1 | type I methionyl aminopeptidase | - |
| DOU31_RS04850 (DOU31_04845) | - | 962511..963419 (+) | 909 | WP_002383768.1 | YihY/virulence factor BrkB family protein | - |
| DOU31_RS04855 (DOU31_04850) | - | 963530..964666 (+) | 1137 | WP_002366956.1 | MraY family glycosyltransferase | - |
| DOU31_RS04860 (DOU31_04855) | - | 964788..965576 (+) | 789 | WP_002359892.1 | glycosyltransferase family 2 protein | - |
| DOU31_RS04865 (DOU31_04860) | - | 965576..966403 (+) | 828 | WP_002369091.1 | glycosyltransferase | - |
| DOU31_RS04870 (DOU31_04865) | - | 966407..967120 (+) | 714 | WP_002356891.1 | glycosyltransferase family 2 protein | - |
| DOU31_RS04875 (DOU31_04870) | rfbA | 967242..968108 (+) | 867 | WP_002364387.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| DOU31_RS04880 (DOU31_04875) | rfbC | 968121..968693 (+) | 573 | WP_002356893.1 | dTDP-4-dehydrorhamnose 3,5-epimerase | - |
| DOU31_RS04885 (DOU31_04880) | rfbB | 968718..969746 (+) | 1029 | WP_002359895.1 | dTDP-glucose 4,6-dehydratase | - |
| DOU31_RS04890 (DOU31_04885) | rfbD | 969839..970681 (+) | 843 | WP_002370379.1 | dTDP-4-dehydrorhamnose reductase | - |
| DOU31_RS04895 (DOU31_04890) | - | 970740..971465 (+) | 726 | WP_002359897.1 | glycosyltransferase family 2 protein | - |
| DOU31_RS04900 (DOU31_04895) | - | 971465..971815 (+) | 351 | WP_002370376.1 | DUF2304 domain-containing protein | - |
| DOU31_RS04905 (DOU31_04900) | - | 971889..972230 (-) | 342 | WP_002356899.1 | EamA family transporter | - |
| DOU31_RS04910 (DOU31_04905) | - | 972478..973272 (+) | 795 | WP_002356900.1 | ABC transporter permease | - |
| DOU31_RS04915 (DOU31_04910) | - | 973285..974502 (+) | 1218 | WP_002356901.1 | ABC transporter ATP-binding protein | - |
| DOU31_RS04920 (DOU31_04915) | - | 974492..977635 (+) | 3144 | WP_010717058.1 | glycosyltransferase | - |
Sequence
Protein
Download Length: 175 a.a. Molecular weight: 19345.20 Da Isoelectric Point: 4.7078
>NTDB_id=298679 DOU31_RS04585 WP_010776361.1 926518..927045(+) (ssb) [Enterococcus faecalis strain C25]
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSVQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSVQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF
Nucleotide
Download Length: 528 bp
>NTDB_id=298679 DOU31_RS04585 WP_010776361.1 926518..927045(+) (ssb) [Enterococcus faecalis strain C25]
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTGTATGTGACTGAAGTTGTTTGCGAAAGCTTCCAATTATTAGAGTCAAAAAG
CACCAATGAGAATAGAAATAGCGTTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTGTATGTGACTGAAGTTGTTTGCGAAAGCTTCCAATTATTAGAGTCAAAAAG
CACCAATGAGAATAGAAATAGCGTTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.551 |
100 |
0.606 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.865 |
100 |
0.589 |