Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DLJ48_RS06670 | Genome accession | NZ_CP029684 |
| Coordinates | 1298593..1299051 (+) | Length | 152 a.a. |
| NCBI ID | WP_128686706.1 | Uniprot ID | - |
| Organism | Oenococcus sicerae strain UCMA15228 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1290243..1337879 | 1298593..1299051 | within | 0 |
Gene organization within MGE regions
Location: 1290243..1337879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DLJ48_RS06595 (DLJ48_06655) | - | 1290243..1290908 (-) | 666 | WP_128686693.1 | deoxynucleoside kinase | - |
| DLJ48_RS06600 (DLJ48_06660) | mscL | 1291064..1291453 (-) | 390 | WP_128686694.1 | large-conductance mechanosensitive channel protein MscL | - |
| DLJ48_RS06610 (DLJ48_06670) | - | 1291786..1292829 (-) | 1044 | WP_128686695.1 | tyrosine-type recombinase/integrase | - |
| DLJ48_RS06615 (DLJ48_06675) | - | 1292845..1293084 (-) | 240 | WP_128686696.1 | helix-turn-helix domain-containing protein | - |
| DLJ48_RS06620 (DLJ48_06680) | - | 1293126..1293380 (-) | 255 | WP_128686697.1 | hypothetical protein | - |
| DLJ48_RS06625 (DLJ48_06685) | - | 1293382..1294026 (-) | 645 | WP_128686698.1 | ion channel | - |
| DLJ48_RS06630 (DLJ48_06690) | - | 1294093..1294911 (-) | 819 | WP_161566117.1 | DUF4428 domain-containing protein | - |
| DLJ48_RS06635 (DLJ48_06695) | - | 1294953..1295597 (-) | 645 | WP_128686699.1 | S24 family peptidase | - |
| DLJ48_RS06640 (DLJ48_06700) | - | 1295726..1295950 (+) | 225 | WP_128686700.1 | helix-turn-helix domain-containing protein | - |
| DLJ48_RS06645 (DLJ48_06705) | - | 1295962..1296162 (+) | 201 | WP_128686701.1 | hypothetical protein | - |
| DLJ48_RS06650 (DLJ48_06710) | - | 1296322..1296582 (+) | 261 | WP_128686702.1 | hypothetical protein | - |
| DLJ48_RS06655 (DLJ48_06715) | - | 1296579..1296965 (+) | 387 | WP_128686703.1 | hypothetical protein | - |
| DLJ48_RS06660 (DLJ48_06720) | - | 1296984..1297922 (+) | 939 | WP_128686704.1 | DUF1351 domain-containing protein | - |
| DLJ48_RS06665 (DLJ48_06725) | - | 1297919..1298596 (+) | 678 | WP_128686705.1 | DUF1071 domain-containing protein | - |
| DLJ48_RS06670 (DLJ48_06730) | ssb | 1298593..1299051 (+) | 459 | WP_128686706.1 | single-stranded DNA-binding protein | Machinery gene |
| DLJ48_RS06675 (DLJ48_06735) | - | 1299064..1299804 (+) | 741 | WP_128686707.1 | conserved phage C-terminal domain-containing protein | - |
| DLJ48_RS06680 (DLJ48_06740) | - | 1299801..1300346 (+) | 546 | WP_128686708.1 | hypothetical protein | - |
| DLJ48_RS06685 (DLJ48_06745) | - | 1300330..1301616 (+) | 1287 | WP_128686709.1 | replicative DNA helicase | - |
| DLJ48_RS06690 (DLJ48_06750) | - | 1301771..1302256 (+) | 486 | WP_128686710.1 | SAM-dependent methyltransferase | - |
| DLJ48_RS06695 (DLJ48_06755) | - | 1302237..1302596 (+) | 360 | WP_243148542.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DLJ48_RS06700 (DLJ48_06760) | - | 1302608..1303099 (+) | 492 | WP_128686712.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DLJ48_RS06705 (DLJ48_06765) | - | 1303258..1304355 (+) | 1098 | WP_128686713.1 | GNAT family N-acetyltransferase | - |
| DLJ48_RS06710 (DLJ48_06770) | - | 1304333..1304710 (+) | 378 | WP_128686714.1 | ASCH domain-containing protein | - |
| DLJ48_RS06715 (DLJ48_08640) | - | 1304813..1304950 (+) | 138 | WP_161566119.1 | hypothetical protein | - |
| DLJ48_RS06720 (DLJ48_06775) | - | 1304947..1306167 (+) | 1221 | WP_128686715.1 | hypothetical protein | - |
| DLJ48_RS06730 (DLJ48_06785) | - | 1306526..1306945 (-) | 420 | WP_128686716.1 | hypothetical protein | - |
| DLJ48_RS06735 (DLJ48_06790) | - | 1306938..1307129 (-) | 192 | WP_174813058.1 | XRE family transcriptional regulator | - |
| DLJ48_RS06740 (DLJ48_06795) | - | 1307126..1307713 (-) | 588 | WP_128686717.1 | hypothetical protein | - |
| DLJ48_RS06745 (DLJ48_06800) | - | 1307848..1308075 (+) | 228 | WP_128686718.1 | hypothetical protein | - |
| DLJ48_RS06750 (DLJ48_06805) | - | 1308072..1308275 (-) | 204 | WP_128686719.1 | hypothetical protein | - |
| DLJ48_RS06755 (DLJ48_06810) | - | 1308418..1308699 (+) | 282 | WP_128686720.1 | hypothetical protein | - |
| DLJ48_RS06760 (DLJ48_06815) | - | 1308738..1309502 (+) | 765 | WP_128686721.1 | terminase small subunit | - |
| DLJ48_RS06765 (DLJ48_06820) | - | 1309492..1310787 (+) | 1296 | WP_420892153.1 | PBSX family phage terminase large subunit | - |
| DLJ48_RS06770 (DLJ48_06825) | - | 1310806..1312269 (+) | 1464 | WP_128686723.1 | phage portal protein | - |
| DLJ48_RS06775 (DLJ48_06830) | - | 1312241..1312549 (+) | 309 | WP_128686724.1 | ribosomal-processing cysteine protease Prp | - |
| DLJ48_RS06780 (DLJ48_06835) | - | 1312539..1313708 (+) | 1170 | WP_128686725.1 | minor capsid protein | - |
| DLJ48_RS06785 (DLJ48_06840) | - | 1313868..1314500 (+) | 633 | WP_128686726.1 | DUF4355 domain-containing protein | - |
| DLJ48_RS06790 (DLJ48_06845) | - | 1314513..1314866 (+) | 354 | WP_128686727.1 | hypothetical protein | - |
| DLJ48_RS06795 (DLJ48_06850) | - | 1314878..1315933 (+) | 1056 | WP_128686728.1 | major capsid protein | - |
| DLJ48_RS06800 (DLJ48_06855) | - | 1315947..1316261 (+) | 315 | WP_128686729.1 | phage head-tail connector protein | - |
| DLJ48_RS06805 (DLJ48_06860) | - | 1316248..1316604 (+) | 357 | WP_128686730.1 | hypothetical protein | - |
| DLJ48_RS06810 (DLJ48_06865) | - | 1316597..1317151 (+) | 555 | WP_128686731.1 | HK97 gp10 family phage protein | - |
| DLJ48_RS06815 (DLJ48_06870) | - | 1317148..1317516 (+) | 369 | WP_128686732.1 | hypothetical protein | - |
| DLJ48_RS06820 (DLJ48_06875) | - | 1317520..1317975 (+) | 456 | WP_128686733.1 | phage tail tube protein | - |
| DLJ48_RS06825 (DLJ48_06880) | - | 1318060..1318458 (+) | 399 | WP_128686734.1 | DUF6096 family protein | - |
| DLJ48_RS06830 (DLJ48_06885) | - | 1318548..1318820 (+) | 273 | WP_128686735.1 | hypothetical protein | - |
| DLJ48_RS08590 | - | 1318853..1320730 (+) | 1878 | WP_243148544.1 | hypothetical protein | - |
| DLJ48_RS08595 | - | 1320791..1322941 (+) | 2151 | WP_243148546.1 | transglycosylase SLT domain-containing protein | - |
| DLJ48_RS06840 (DLJ48_06895) | - | 1322956..1323321 (+) | 366 | WP_128686736.1 | DUF6711 family protein | - |
| DLJ48_RS08600 | - | 1323336..1327805 (+) | 4470 | WP_243148548.1 | hypothetical protein | - |
| DLJ48_RS06850 (DLJ48_08645) | - | 1327828..1327971 (+) | 144 | WP_161566120.1 | hypothetical protein | - |
| DLJ48_RS06855 (DLJ48_06905) | - | 1327974..1328204 (+) | 231 | WP_128686737.1 | hypothetical protein | - |
| DLJ48_RS06860 (DLJ48_06910) | - | 1328238..1328504 (+) | 267 | WP_243148550.1 | hypothetical protein | - |
| DLJ48_RS06865 (DLJ48_06915) | - | 1328574..1328975 (+) | 402 | WP_128686738.1 | phage holin, LLH family | - |
| DLJ48_RS06870 (DLJ48_06920) | - | 1328975..1330036 (+) | 1062 | WP_128686739.1 | GH25 family lysozyme | - |
| DLJ48_RS06875 (DLJ48_06925) | - | 1330225..1330698 (+) | 474 | WP_128686740.1 | hypothetical protein | - |
| DLJ48_RS06880 (DLJ48_06930) | - | 1330904..1331968 (+) | 1065 | WP_128686741.1 | DNA cytosine methyltransferase | - |
| DLJ48_RS06885 (DLJ48_06935) | - | 1331972..1333936 (+) | 1965 | WP_128686742.1 | ATP-binding protein | - |
| DLJ48_RS06890 (DLJ48_06940) | - | 1333914..1335161 (+) | 1248 | WP_128686743.1 | MrcB family domain-containing protein | - |
| DLJ48_RS06895 (DLJ48_06945) | - | 1335480..1335734 (+) | 255 | WP_128686744.1 | hypothetical protein | - |
| DLJ48_RS06900 (DLJ48_06950) | - | 1335904..1336584 (+) | 681 | WP_128686745.1 | hypothetical protein | - |
| DLJ48_RS06905 (DLJ48_06955) | - | 1337286..1337879 (+) | 594 | WP_128686746.1 | TMEM175 family protein | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 16937.80 Da Isoelectric Point: 5.2868
>NTDB_id=295242 DLJ48_RS06670 WP_128686706.1 1298593..1299051(+) (ssb) [Oenococcus sicerae strain UCMA15228]
MINRVVLVGRVTKDIELRYTGSGDAVGSFTLAVERNFKNKAGDRETDFVSCVIWRKPAENLANFTGKGAMLGIEGRLQTR
TYDNDQQLKVYVTEIVVDNFQLLETRAESEARRTSNGSSQQPVDNHGTGTNVNNSVRNQKPNVEIDDSDLPF
MINRVVLVGRVTKDIELRYTGSGDAVGSFTLAVERNFKNKAGDRETDFVSCVIWRKPAENLANFTGKGAMLGIEGRLQTR
TYDNDQQLKVYVTEIVVDNFQLLETRAESEARRTSNGSSQQPVDNHGTGTNVNNSVRNQKPNVEIDDSDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=295242 DLJ48_RS06670 WP_128686706.1 1298593..1299051(+) (ssb) [Oenococcus sicerae strain UCMA15228]
ATGATTAATCGAGTTGTACTAGTTGGCAGAGTAACTAAAGATATCGAACTGCGCTACACGGGTTCAGGTGATGCCGTTGG
CTCATTCACATTAGCAGTTGAACGAAATTTCAAGAACAAAGCAGGTGATCGTGAAACAGATTTTGTTTCTTGCGTTATCT
GGAGAAAACCAGCCGAAAACCTAGCCAATTTCACTGGCAAAGGCGCCATGCTGGGCATTGAAGGTAGACTGCAAACGCGC
ACTTATGACAACGACCAACAACTGAAAGTTTATGTGACCGAAATCGTGGTTGATAACTTTCAGTTGTTGGAAACGCGGGC
TGAAAGTGAAGCAAGAAGAACTAGCAATGGCAGCAGCCAACAACCAGTTGACAACCACGGAACTGGCACGAATGTCAATA
ACAGTGTGAGGAATCAAAAACCAAATGTTGAGATTGATGATTCAGATTTGCCATTTTAG
ATGATTAATCGAGTTGTACTAGTTGGCAGAGTAACTAAAGATATCGAACTGCGCTACACGGGTTCAGGTGATGCCGTTGG
CTCATTCACATTAGCAGTTGAACGAAATTTCAAGAACAAAGCAGGTGATCGTGAAACAGATTTTGTTTCTTGCGTTATCT
GGAGAAAACCAGCCGAAAACCTAGCCAATTTCACTGGCAAAGGCGCCATGCTGGGCATTGAAGGTAGACTGCAAACGCGC
ACTTATGACAACGACCAACAACTGAAAGTTTATGTGACCGAAATCGTGGTTGATAACTTTCAGTTGTTGGAAACGCGGGC
TGAAAGTGAAGCAAGAAGAACTAGCAATGGCAGCAGCCAACAACCAGTTGACAACCACGGAACTGGCACGAATGTCAATA
ACAGTGTGAGGAATCAAAAACCAAATGTTGAGATTGATGATTCAGATTTGCCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.586 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
45.087 |
100 |
0.513 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.218 |
78.289 |
0.362 |