Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DKG76_RS16755 Genome accession   NZ_CP029465
Coordinates   3340751..3340891 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus inaquosorum strain KCTC 13429     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3335751..3345891
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DKG76_RS16730 (DKG76_16730) - 3336102..3336482 (-) 381 WP_019259331.1 hotdog fold thioesterase -
  DKG76_RS16735 (DKG76_16735) comA 3336501..3337145 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  DKG76_RS16740 (DKG76_16740) comP 3337226..3339523 (-) 2298 WP_032732271.1 histidine kinase Regulator
  DKG76_RS16745 (DKG76_16745) comX 3339531..3339692 (-) 162 WP_003241045.1 competence pheromone ComX -
  DKG76_RS16750 (DKG76_16750) - 3339707..3340567 (-) 861 WP_032732270.1 polyprenyl synthetase family protein -
  DKG76_RS16755 (DKG76_16755) degQ 3340751..3340891 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  DKG76_RS22010 - 3341071..3341238 (+) 168 WP_119914210.1 hypothetical protein -
  DKG76_RS16760 (DKG76_16760) - 3341351..3341719 (+) 369 WP_003241042.1 hypothetical protein -
  DKG76_RS16765 (DKG76_16765) pdeH 3341695..3342924 (-) 1230 WP_003241041.1 cyclic di-GMP phosphodiesterase -
  DKG76_RS16770 (DKG76_16770) - 3343061..3344533 (-) 1473 WP_003241040.1 nicotinate phosphoribosyltransferase -
  DKG76_RS16775 (DKG76_16775) - 3344549..3345100 (-) 552 WP_003241039.1 isochorismatase family cysteine hydrolase -
  DKG76_RS16780 (DKG76_16780) - 3345197..3345595 (-) 399 WP_003241038.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=292759 DKG76_RS16755 WP_003220708.1 3340751..3340891(-) (degQ) [Bacillus inaquosorum strain KCTC 13429]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=292759 DKG76_RS16755 WP_003220708.1 3340751..3340891(-) (degQ) [Bacillus inaquosorum strain KCTC 13429]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACAACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment