Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DKE43_RS10710 Genome accession   NZ_CP029464
Coordinates   2030209..2030349 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain ZB201701     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2025209..2035349
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DKE43_RS10685 (DKE43_10720) - 2025528..2025917 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  DKE43_RS10690 (DKE43_10725) comA 2025941..2026582 (-) 642 WP_060597210.1 response regulator transcription factor Regulator
  DKE43_RS10695 (DKE43_10730) comP 2026663..2028969 (-) 2307 WP_127687103.1 ATP-binding protein Regulator
  DKE43_RS10700 (DKE43_10735) comX 2028983..2029165 (-) 183 WP_317615021.1 competence pheromone ComX -
  DKE43_RS10705 (DKE43_10740) - 2029134..2030057 (-) 924 WP_106071456.1 polyprenyl synthetase family protein -
  DKE43_RS10710 (DKE43_10745) degQ 2030209..2030349 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  DKE43_RS10715 (DKE43_10750) - 2030855..2031208 (+) 354 WP_060597216.1 hypothetical protein -
  DKE43_RS10720 (DKE43_10755) - 2031242..2032468 (-) 1227 WP_106072124.1 HDOD domain-containing protein -
  DKE43_RS10725 (DKE43_10760) - 2032607..2034016 (-) 1410 WP_240667883.1 nicotinate phosphoribosyltransferase -
  DKE43_RS10730 (DKE43_10765) - 2034094..2034645 (-) 552 WP_127687105.1 isochorismatase family cysteine hydrolase -
  DKE43_RS10735 (DKE43_10770) - 2034706..2035113 (-) 408 WP_060597219.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=292676 DKE43_RS10710 WP_003213123.1 2030209..2030349(-) (degQ) [Bacillus pumilus strain ZB201701]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=292676 DKE43_RS10710 WP_003213123.1 2030209..2030349(-) (degQ) [Bacillus pumilus strain ZB201701]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment