Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DIC78_RS15300 Genome accession   NZ_CP029364
Coordinates   3005664..3005804 (+) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain ZB201702     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3000664..3010804
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DIC78_RS15275 (DIC78_15300) - 3001002..3001361 (+) 360 WP_420867036.1 YueI family protein -
  DIC78_RS15280 (DIC78_15305) - 3001458..3002009 (+) 552 WP_127696526.1 cysteine hydrolase family protein -
  DIC78_RS15285 (DIC78_15310) - 3002025..3003494 (+) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  DIC78_RS15290 (DIC78_15315) - 3003630..3004859 (+) 1230 WP_127696527.1 EAL and HDOD domain-containing protein -
  DIC78_RS15295 (DIC78_15320) - 3004835..3005203 (-) 369 WP_106022008.1 hypothetical protein -
  DIC78_RS15300 (DIC78_15325) degQ 3005664..3005804 (+) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  DIC78_RS15305 (DIC78_15330) - 3006012..3006869 (+) 858 WP_164848141.1 polyprenyl synthetase family protein -
  DIC78_RS15310 (DIC78_15335) comX 3006838..3007011 (+) 174 WP_127696529.1 competence pheromone ComX -
  DIC78_RS15315 (DIC78_15340) comP 3007025..3009328 (+) 2304 WP_127696530.1 histidine kinase Regulator
  DIC78_RS15320 (DIC78_15345) comA 3009409..3010053 (+) 645 WP_024122680.1 two-component system response regulator ComA Regulator
  DIC78_RS15325 (DIC78_15350) - 3010071..3010451 (+) 381 WP_044158943.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=291987 DIC78_RS15300 WP_024122683.1 3005664..3005804(+) (degQ) [Bacillus halotolerans strain ZB201702]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=291987 DIC78_RS15300 WP_024122683.1 3005664..3005804(+) (degQ) [Bacillus halotolerans strain ZB201702]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978

Multiple sequence alignment