Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DDT10_RS14805 Genome accession   NZ_CP029071
Coordinates   3019169..3019309 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain ALB79     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3014169..3024309
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDT10_RS14780 (DDT10_14780) - 3014466..3014849 (-) 384 WP_053574130.1 hotdog fold thioesterase -
  DDT10_RS14785 (DDT10_14785) comA 3014871..3015515 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  DDT10_RS14790 (DDT10_14790) comP 3015596..3017899 (-) 2304 WP_040238945.1 histidine kinase Regulator
  DDT10_RS14795 (DDT10_14795) comX 3017919..3018098 (-) 180 WP_306383677.1 competence pheromone ComX -
  DDT10_RS14800 (DDT10_14800) comQ 3018052..3019038 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DDT10_RS14805 (DDT10_14805) degQ 3019169..3019309 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DDT10_RS14815 (DDT10_14815) - 3019772..3020113 (+) 342 WP_007408677.1 hypothetical protein -
  DDT10_RS14820 (DDT10_14820) - 3020120..3021343 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  DDT10_RS14825 (DDT10_14825) - 3021473..3022939 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  DDT10_RS14830 (DDT10_14830) - 3022957..3023508 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  DDT10_RS14835 (DDT10_14835) - 3023605..3024003 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=290061 DDT10_RS14805 WP_003152043.1 3019169..3019309(-) (degQ) [Bacillus amyloliquefaciens strain ALB79]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=290061 DDT10_RS14805 WP_003152043.1 3019169..3019309(-) (degQ) [Bacillus amyloliquefaciens strain ALB79]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment