Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   DDT10_RS11830 Genome accession   NZ_CP029071
Coordinates   2459238..2459675 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain ALB79     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2454238..2464675
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDT10_RS11780 (DDT10_11780) sinI 2454622..2454795 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  DDT10_RS11785 (DDT10_11785) sinR 2454829..2455164 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DDT10_RS11790 (DDT10_11790) - 2455212..2455997 (-) 786 WP_007408329.1 TasA family protein -
  DDT10_RS11795 (DDT10_11795) - 2456062..2456646 (-) 585 WP_015240205.1 signal peptidase I -
  DDT10_RS11800 (DDT10_11800) tapA 2456618..2457289 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  DDT10_RS11805 (DDT10_11805) - 2457548..2457877 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  DDT10_RS11810 (DDT10_11810) - 2457917..2458096 (-) 180 WP_003153093.1 YqzE family protein -
  DDT10_RS11815 (DDT10_11815) comGG 2458153..2458530 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  DDT10_RS11820 (DDT10_11820) comGF 2458531..2459031 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  DDT10_RS11825 (DDT10_11825) comGE 2458940..2459254 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  DDT10_RS11830 (DDT10_11830) comGD 2459238..2459675 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  DDT10_RS11835 (DDT10_11835) comGC 2459665..2459973 (-) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  DDT10_RS11840 (DDT10_11840) comGB 2459978..2461015 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  DDT10_RS11845 (DDT10_11845) comGA 2461002..2462072 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  DDT10_RS11850 (DDT10_11850) - 2462265..2463215 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  DDT10_RS11855 (DDT10_11855) - 2463361..2464662 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=290042 DDT10_RS11830 WP_012117983.1 2459238..2459675(-) (comGD) [Bacillus amyloliquefaciens strain ALB79]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=290042 DDT10_RS11830 WP_012117983.1 2459238..2459675(-) (comGD) [Bacillus amyloliquefaciens strain ALB79]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572


Multiple sequence alignment