Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DDT10_RS11780 | Genome accession | NZ_CP029071 |
| Coordinates | 2454622..2454795 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain ALB79 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2449622..2459795
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DDT10_RS11765 (DDT10_11765) | gcvT | 2450435..2451535 (-) | 1101 | WP_053573200.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DDT10_RS11770 (DDT10_11770) | - | 2451959..2453629 (+) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| DDT10_RS11775 (DDT10_11775) | - | 2453651..2454445 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| DDT10_RS11780 (DDT10_11780) | sinI | 2454622..2454795 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| DDT10_RS11785 (DDT10_11785) | sinR | 2454829..2455164 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| DDT10_RS11790 (DDT10_11790) | - | 2455212..2455997 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| DDT10_RS11795 (DDT10_11795) | - | 2456062..2456646 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| DDT10_RS11800 (DDT10_11800) | tapA | 2456618..2457289 (-) | 672 | WP_053573199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DDT10_RS11805 (DDT10_11805) | - | 2457548..2457877 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| DDT10_RS11810 (DDT10_11810) | - | 2457917..2458096 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| DDT10_RS11815 (DDT10_11815) | comGG | 2458153..2458530 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| DDT10_RS11820 (DDT10_11820) | comGF | 2458531..2459031 (-) | 501 | WP_256052909.1 | competence type IV pilus minor pilin ComGF | - |
| DDT10_RS11825 (DDT10_11825) | comGE | 2458940..2459254 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| DDT10_RS11830 (DDT10_11830) | comGD | 2459238..2459675 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=290039 DDT10_RS11780 WP_003153105.1 2454622..2454795(+) (sinI) [Bacillus amyloliquefaciens strain ALB79]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=290039 DDT10_RS11780 WP_003153105.1 2454622..2454795(+) (sinI) [Bacillus amyloliquefaciens strain ALB79]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |