Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   DDE72_RS05005 Genome accession   NZ_CP029034
Coordinates   933975..934148 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain LDO2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 928975..939148
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDE72_RS04955 (DDE72_04955) comGD 929094..929531 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  DDE72_RS04960 (DDE72_04960) comGE 929515..929829 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  DDE72_RS04965 (DDE72_04965) comGF 929774..930238 (+) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  DDE72_RS04970 (DDE72_04970) comGG 930239..930616 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  DDE72_RS04975 (DDE72_04975) - 930673..930852 (+) 180 WP_022552966.1 YqzE family protein -
  DDE72_RS04980 (DDE72_04980) - 930893..931222 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  DDE72_RS04985 (DDE72_04985) tapA 931481..932152 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  DDE72_RS04990 (DDE72_04990) - 932124..932708 (+) 585 WP_032874025.1 signal peptidase I -
  DDE72_RS04995 (DDE72_04995) - 932773..933558 (+) 786 WP_032874027.1 TasA family protein -
  DDE72_RS05000 (DDE72_05000) sinR 933606..933941 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DDE72_RS05005 (DDE72_05005) sinI 933975..934148 (-) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  DDE72_RS05010 (DDE72_05010) - 934325..935119 (-) 795 WP_007612541.1 YqhG family protein -
  DDE72_RS05015 (DDE72_05015) - 935141..936811 (-) 1671 WP_032874031.1 SNF2-related protein -
  DDE72_RS05020 (DDE72_05020) gcvT 937234..938334 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=289499 DDE72_RS05005 WP_032874029.1 933975..934148(-) (sinI) [Bacillus velezensis strain LDO2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=289499 DDE72_RS05005 WP_032874029.1 933975..934148(-) (sinI) [Bacillus velezensis strain LDO2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment